mRNA_M-pyrifera_M_contig8632.20107.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8632.20107.1 vs. uniprot
Match: A0A6H5L6N4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6N4_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 5.510e-6 Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 2 Query: 2 AKRAYEELSLRSRENQNTQNAGLRFVAEEREKYRQRQTQDMMQRARER 145 A +AYEE S R ENQ++ NAGLR VAEE+EKYRQ+Q + M+Q A ER Sbjct: 546 ANQAYEERSRRETENQDSTNAGLRLVAEEKEKYRQQQAEKMLQAASER 593 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8632.20107.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8632.20107.1 >prot_M-pyrifera_M_contig8632.20107.1 ID=prot_M-pyrifera_M_contig8632.20107.1|Name=mRNA_M-pyrifera_M_contig8632.20107.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=98bp RQACVRGALAQVARKSEHPERRPAVRSGRKGEVQATPDARHDATRAGKKAback to top mRNA from alignment at M-pyrifera_M_contig8632:4087..5205+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8632.20107.1 ID=mRNA_M-pyrifera_M_contig8632.20107.1|Name=mRNA_M-pyrifera_M_contig8632.20107.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=1119bp|location=Sequence derived from alignment at M-pyrifera_M_contig8632:4087..5205+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8632:4087..5205+ >mRNA_M-pyrifera_M_contig8632.20107.1 ID=mRNA_M-pyrifera_M_contig8632.20107.1|Name=mRNA_M-pyrifera_M_contig8632.20107.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=588bp|location=Sequence derived from alignment at M-pyrifera_M_contig8632:4087..5205+ (Macrocystis pyrifera P11B4 male)back to top |