prot_M-pyrifera_M_contig86064.20060.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86064.20060.1 vs. uniprot
Match: A0A2G9H4R2_9LAMI (E3 ubiquitin-protein ligase RNF170 n=1 Tax=Handroanthus impetiginosus TaxID=429701 RepID=A0A2G9H4R2_9LAMI) HSP 1 Score: 50.4 bits (119), Expect = 4.860e-5 Identity = 38/105 (36.19%), Postives = 58/105 (55.24%), Query Frame = 0 Query: 10 LTFVDQYNAVCGG-GGGVGAVATEAPWLLSRLFHDPTGI-RSIVCSSYAFFFLAPIVSSLAYAFLPVDLIPDASLPFLGFIDDIIVIIVALVIMAGVYRAWVVEQ 112 L + +YN + G G+ + P+LL RL D RS+ +LA I S+L Y PVD+IP+A L LGF+DD+I+I + + +A +YRA +V + Sbjct: 78 LQGIQRYNRLYGERSNGLFQRMQDLPFLLKRLLRDIMDPQRSLPLVLRTRVYLAVIGSAL-YVISPVDIIPEALLGILGFVDDLIIIFICFLHVAALYRAVLVSR 181 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86064.20060.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig86064.20060.1 ID=prot_M-pyrifera_M_contig86064.20060.1|Name=mRNA_M-pyrifera_M_contig86064.20060.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|