mRNA_M-pyrifera_M_contig859.20024.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig859.20024.1 vs. uniprot
Match: D7FT60_ECTSI (Nitroreductase-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT60_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 4.060e-10 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = 3 Query: 3 VCIGYPSEEQRDFKTLRFDPGEVFHREVFGTTLEGIPSL 119 V IGYPS+++R+ KTLRF P EV HRE FGT LEG+PSL Sbjct: 279 VSIGYPSDDRREIKTLRFPPEEVLHREEFGTPLEGVPSL 317 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig859.20024.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig859.20024.1 >prot_M-pyrifera_M_contig859.20024.1 ID=prot_M-pyrifera_M_contig859.20024.1|Name=mRNA_M-pyrifera_M_contig859.20024.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bp WFASDTRPRNSEILKRSGLTPVRFSTEKCSVPRWKGSRRYEGYHGGPRPRback to top mRNA from alignment at M-pyrifera_M_contig859:26000..26859- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig859.20024.1 ID=mRNA_M-pyrifera_M_contig859.20024.1|Name=mRNA_M-pyrifera_M_contig859.20024.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=860bp|location=Sequence derived from alignment at M-pyrifera_M_contig859:26000..26859- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig859:26000..26859- >mRNA_M-pyrifera_M_contig859.20024.1 ID=mRNA_M-pyrifera_M_contig859.20024.1|Name=mRNA_M-pyrifera_M_contig859.20024.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=408bp|location=Sequence derived from alignment at M-pyrifera_M_contig859:26000..26859- (Macrocystis pyrifera P11B4 male)back to top |