mRNA_M-pyrifera_M_contig83556.19516.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A6I8LJU0_9PSEU (Mobile element protein n=2 Tax=Amycolatopsis TaxID=1813 RepID=A0A6I8LJU0_9PSEU) HSP 1 Score: 55.1 bits (131), Expect = 8.190e-7 Identity = 26/48 (54.17%), Postives = 30/48 (62.50%), Query Frame = 1 Query: 127 MPTMTEPDNGVTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 M TMT P VTVG DTH +THV LD +GR+LA F AD GY + Sbjct: 1 MSTMTNPGAHVTVGVDTHLETHVAVALDQVGRVLAQQSFPADPPGYRS 48
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A7K2BBM2_9ACTN (IS110 family transposase n=1 Tax=Acidimicrobiia bacterium TaxID=2080302 RepID=A0A7K2BBM2_9ACTN) HSP 1 Score: 50.1 bits (118), Expect = 2.260e-6 Identity = 22/33 (66.67%), Postives = 25/33 (75.76%), Query Frame = 1 Query: 166 GADTHADTHVGAVLDPLGRLLATNEFAADHAGY 264 GADTH DTHVGAV+D GRLL + +F D AGY Sbjct: 4 GADTHRDTHVGAVVDSTGRLLGSAQFRTDTAGY 36
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: UPI001CC2FE22 (IS110 family transposase n=5 Tax=Microbispora TaxID=2005 RepID=UPI001CC2FE22) HSP 1 Score: 53.5 bits (127), Expect = 2.900e-6 Identity = 24/41 (58.54%), Postives = 28/41 (68.29%), Query Frame = 1 Query: 148 DNGVTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 D V G DTH DTH AV+DP+GR+L T +F AD AGY A Sbjct: 11 DFEVAGGVDTHQDTHTAAVIDPIGRVLGTEQFPADPAGYAA 51
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: UPI00137723A9 (IS110 family transposase n=1 Tax=Micromonospora rubida TaxID=2697657 RepID=UPI00137723A9) HSP 1 Score: 53.1 bits (126), Expect = 3.960e-6 Identity = 24/38 (63.16%), Postives = 27/38 (71.05%), Query Frame = 1 Query: 157 VTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 VT G DTH DTH AVLDP+GR+L T +F A AGY A Sbjct: 14 VTGGVDTHLDTHTAAVLDPIGRVLGTQQFPATAAGYAA 51
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A239HRF9_9ACTN (Transposase n=2 Tax=Actinomadura mexicana TaxID=134959 RepID=A0A239HRF9_9ACTN) HSP 1 Score: 49.7 bits (117), Expect = 4.830e-6 Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 1 Query: 166 GADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 G DTH DTH AV+D +GR+L T +F AD AGY A Sbjct: 16 GVDTHQDTHTAAVIDQVGRVLGTEQFPADAAGYAA 50
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A4R6J6H8_9ACTN (Transposase n=1 Tax=Actinoplanes brasiliensis TaxID=52695 RepID=A0A4R6J6H8_9ACTN) HSP 1 Score: 52.8 bits (125), Expect = 5.400e-6 Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 1 Query: 127 MPTMTEPDNGVTV--GADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 MP++T + + V G DTH DTH AV+D +GR+L T +F AD AGY A Sbjct: 1 MPSITPDEAAIDVFGGVDTHQDTHTAAVIDQIGRVLGTQQFPADAAGYTA 50
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A5N8VSP4_9ACTN (IS110 family transposase n=1 Tax=Streptomyces adustus TaxID=1609272 RepID=A0A5N8VSP4_9ACTN) HSP 1 Score: 52.8 bits (125), Expect = 5.430e-6 Identity = 26/41 (63.41%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 145 PDNG-VTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGY 264 PD+G V +G DTH DTHV AVL PLG +LAT+ F A AGY Sbjct: 12 PDDGEVILGVDTHKDTHVAAVLTPLGAILATDAFPATSAGY 52
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A8J4E5F8_9ACTN (IS110 family transposase n=1 Tax=Virgisporangium aurantiacum TaxID=175570 RepID=A0A8J4E5F8_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 7.400e-6 Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 1 Query: 157 VTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 VT G DTH DTH AV+DP+GR+L T +F A AGY A Sbjct: 14 VTGGVDTHQDTHTAAVIDPIGRVLGTQQFPATAAGYAA 51
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: A0A7W3R709_9ACTN (Transposase n=4 Tax=Thermomonosporaceae TaxID=2012 RepID=A0A7W3R709_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 7.400e-6 Identity = 26/50 (52.00%), Postives = 32/50 (64.00%), Query Frame = 1 Query: 127 MPTMTEPDNG--VTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 MP++T VT G DTH DTH AV+D +GR+L T +F AD AGY A Sbjct: 1 MPSITPQQQAFEVTGGVDTHQDTHTAAVIDQVGRVLGTEQFPADAAGYTA 50
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Match: UPI00117E58FD (IS110 family transposase n=2 Tax=Streptosporangiaceae TaxID=2004 RepID=UPI00117E58FD) HSP 1 Score: 52.0 bits (123), Expect = 1.020e-5 Identity = 26/49 (53.06%), Postives = 32/49 (65.31%), Query Frame = 1 Query: 124 AMPTMTEPDNGVTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEA 270 A PT + D+ + +G DTHADTHV AV+ LGRL+AT F AGY A Sbjct: 6 AEPTRVD-DDEIVLGVDTHADTHVAAVVTTLGRLMATRSFPTTAAGYTA 53 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83556.19516.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 23
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig83556.19516.1 >prot_M-pyrifera_M_contig83556.19516.1 ID=prot_M-pyrifera_M_contig83556.19516.1|Name=mRNA_M-pyrifera_M_contig83556.19516.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=48bp MPTMTEPDNGVTVGADTHADTHVGAVLDPLGRLLATNEFAADHAGYEAback to top mRNA from alignment at M-pyrifera_M_contig83556:614..883+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig83556.19516.1 ID=mRNA_M-pyrifera_M_contig83556.19516.1|Name=mRNA_M-pyrifera_M_contig83556.19516.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=270bp|location=Sequence derived from alignment at M-pyrifera_M_contig83556:614..883+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig83556:614..883+ >mRNA_M-pyrifera_M_contig83556.19516.1 ID=mRNA_M-pyrifera_M_contig83556.19516.1|Name=mRNA_M-pyrifera_M_contig83556.19516.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=288bp|location=Sequence derived from alignment at M-pyrifera_M_contig83556:614..883+ (Macrocystis pyrifera P11B4 male)back to top |