mRNA_M-pyrifera_M_contig83443.19487.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83443.19487.1 vs. uniprot
Match: A0A7C7P1E8_9BACT (Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A7C7P1E8_9BACT) HSP 1 Score: 78.6 bits (192), Expect = 2.350e-16 Identity = 39/63 (61.90%), Postives = 48/63 (76.19%), Query Frame = 1 Query: 4 LLVDRATAITWSKTMARKGISPMKKVLDKLFGTGTRVAKQAFRAYQNWLERHPPLPIGDVLFK 192 LLVDR TAI W+KTM KGISPM K+LDK+F TG +VAK+AF+ ++ L R+P LP DVL K Sbjct: 124 LLVDRQTAIEWAKTMTWKGISPMVKILDKVFETGAKVAKKAFQLLRDRLHRNPLLPKWDVLIK 186
BLAST of mRNA_M-pyrifera_M_contig83443.19487.1 vs. uniprot
Match: A0A0F8Z2B5_9ZZZZ (Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8Z2B5_9ZZZZ) HSP 1 Score: 49.3 bits (116), Expect = 3.560e-5 Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 4 LLVDRATAITWSKTMARKGISPMKKVLDKLFGTGTRVAKQAFRAYQNWLERHPPLP 171 LL TA+ W+KTM +G++P+ +LD+++ TG R++++AFR LER LP Sbjct: 141 LLSTIETAVQWAKTMTWRGVAPIVHLLDRVYETGVRLSRRAFRPIAARLERSESLP 196 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83443.19487.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig83443.19487.1 >prot_M-pyrifera_M_contig83443.19487.1 ID=prot_M-pyrifera_M_contig83443.19487.1|Name=mRNA_M-pyrifera_M_contig83443.19487.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=75bp GLLVDRATAITWSKTMARKGISPMKKVLDKLFGTGTRVAKQAFRAYQNWLback to top mRNA from alignment at M-pyrifera_M_contig83443:398..622+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig83443.19487.1 ID=mRNA_M-pyrifera_M_contig83443.19487.1|Name=mRNA_M-pyrifera_M_contig83443.19487.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=225bp|location=Sequence derived from alignment at M-pyrifera_M_contig83443:398..622+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig83443:398..622+ >mRNA_M-pyrifera_M_contig83443.19487.1 ID=mRNA_M-pyrifera_M_contig83443.19487.1|Name=mRNA_M-pyrifera_M_contig83443.19487.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=450bp|location=Sequence derived from alignment at M-pyrifera_M_contig83443:398..622+ (Macrocystis pyrifera P11B4 male)back to top |