prot_M-pyrifera_M_contig100857.191.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100857.191.1 vs. uniprot
Match: A0A5A8CFC9_CAFRO (Uncharacterized protein n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8CFC9_CAFRO) HSP 1 Score: 101 bits (251), Expect = 8.210e-23 Identity = 52/99 (52.53%), Postives = 65/99 (65.66%), Query Frame = 0 Query: 3 EAAVRRSFTLMALLTGAHGLGERLLSLRAAASYKSLIRVFDPECRGSFHHVCAVLQKLVLSRPADVAAAVLDSGPTHIQRMLRFLHHPPVADTVLQLLT 101 E A S TL LL G G LL+ + SL+RVF P RGSFHH C VLQ+LVL+ P DVA A++ GP ++R++ FLHHPPVADT++QLLT Sbjct: 472 EGAQATSLTLTRLLIKPDGDGCALLAAAPREATASLLRVFSPHSRGSFHHACTVLQRLVLAHPHDVAEALVALGPAPLRRLMAFLHHPPVADTLIQLLT 570 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100857.191.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100857.191.1 ID=prot_M-pyrifera_M_contig100857.191.1|Name=mRNA_M-pyrifera_M_contig100857.191.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=101bpback to top |