mRNA_M-pyrifera_M_contig81550.19083.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81550.19083.1 vs. uniprot
Match: A0A353ZEA6_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A353ZEA6_9PLAN) HSP 1 Score: 53.5 bits (127), Expect = 2.810e-6 Identity = 32/88 (36.36%), Postives = 44/88 (50.00%), Query Frame = 1 Query: 4 IAGIAPITDTGGTFRLR--HFVGDGVGIQDSSSSLGAFLPLSASDEFLFFDGQYSLTNEANSVGNLGLGFREFNPANNRLWGVSLWYD 261 IAG A D GG + R H G G+ + + F + LF D ++ +TN GNLG G+R F P +R++G SLWYD Sbjct: 38 IAGTAVRADDGGGVQARIGHIEGQGIPQVQPVTPIELFPYYEFDQQLLFNDSRFVITNSGGLGGNLGFGYRFFEPETDRVYGGSLWYD 125
BLAST of mRNA_M-pyrifera_M_contig81550.19083.1 vs. uniprot
Match: A0A518IPT2_9BACT (Uncharacterized protein n=2 Tax=Rosistilla oblonga TaxID=2527990 RepID=A0A518IPT2_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 1.340e-5 Identity = 32/80 (40.00%), Postives = 43/80 (53.75%), Query Frame = 1 Query: 34 GGTFRLRHFVGDGVGIQDSSSSLGAFLPLS--ASDEFLFFDGQYSLTNEANSV--GNLGLGFREFNPANNRLWGVSLWYD 261 G + L H G+GVG+ D + +GAF+PL +SD F D L NE GNLG G R F+ NR++G +YD Sbjct: 41 GARYGLGHVAGEGVGLDDGYTRIGAFVPLMQPSSDVLFFTDTHLLLYNEQTEAKGGNLGGGVRYFDATMNRIFGGYTYYD 120 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81550.19083.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81550.19083.1 >prot_M-pyrifera_M_contig81550.19083.1 ID=prot_M-pyrifera_M_contig81550.19083.1|Name=mRNA_M-pyrifera_M_contig81550.19083.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=87bp NIAGIAPITDTGGTFRLRHFVGDGVGIQDSSSSLGAFLPLSASDEFLFFDback to top mRNA from alignment at M-pyrifera_M_contig81550:3..263- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81550.19083.1 ID=mRNA_M-pyrifera_M_contig81550.19083.1|Name=mRNA_M-pyrifera_M_contig81550.19083.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=261bp|location=Sequence derived from alignment at M-pyrifera_M_contig81550:3..263- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81550:3..263- >mRNA_M-pyrifera_M_contig81550.19083.1 ID=mRNA_M-pyrifera_M_contig81550.19083.1|Name=mRNA_M-pyrifera_M_contig81550.19083.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=522bp|location=Sequence derived from alignment at M-pyrifera_M_contig81550:3..263- (Macrocystis pyrifera P11B4 male)back to top |