prot_M-pyrifera_M_contig81308.19017.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81308.19017.1 vs. uniprot
Match: A0A7S3GCL0_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Palpitomonas bilix TaxID=652834 RepID=A0A7S3GCL0_9EUKA) HSP 1 Score: 60.1 bits (144), Expect = 1.820e-9 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 0 Query: 4 AALARAVAEKEAELSAMTAYRVRHLERLVEEKEVGLREAQHRFERLREDFEYNLGLLRERDAELEAW 70 AAL + V +KE EL+ + A+RV+ LE EKE + QHRF+RL+EDF+YNL L+ ERD ELE + Sbjct: 28 AALGKLVEDKERELAEIHAFRVKSLEAAAVEKEERIGNLQHRFDRLKEDFKYNLRLIEERDEELERY 94
BLAST of mRNA_M-pyrifera_M_contig81308.19017.1 vs. uniprot
Match: A0A7S3GCK7_9EUKA (Hypothetical protein n=2 Tax=Palpitomonas bilix TaxID=652834 RepID=A0A7S3GCK7_9EUKA) HSP 1 Score: 60.1 bits (144), Expect = 6.810e-9 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 0 Query: 4 AALARAVAEKEAELSAMTAYRVRHLERLVEEKEVGLREAQHRFERLREDFEYNLGLLRERDAELEAW 70 AAL + V +KE EL+ + A+RV+ LE EKE + QHRF+RL+EDF+YNL L+ ERD ELE + Sbjct: 28 AALGKLVEDKERELAEIHAFRVKSLEAAAVEKEERIGNLQHRFDRLKEDFKYNLRLIEERDEELERY 94
BLAST of mRNA_M-pyrifera_M_contig81308.19017.1 vs. uniprot
Match: A0A7S2WNF5_9STRA (Hypothetical protein n=1 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2WNF5_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 6.180e-5 Identity = 27/58 (46.55%), Postives = 39/58 (67.24%), Query Frame = 0 Query: 10 VAEKEAELSAMTAYRVRHLERLVEEKEVGLREAQHRFERLREDFEYNLGLLRERDAEL 67 + +KE EL + YR+R LE+ + EKE L + RF +L+EDF+YNL L+ +RD EL Sbjct: 98 IQQKEKELHDINDYRIRSLEQSLREKESQLEVQRERFSKLKEDFQYNLKLIEDRDTEL 155
BLAST of mRNA_M-pyrifera_M_contig81308.19017.1 vs. uniprot
Match: D7FLG3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLG3_ECTSI) HSP 1 Score: 48.5 bits (114), Expect = 8.400e-5 Identity = 27/62 (43.55%), Postives = 44/62 (70.97%), Query Frame = 0 Query: 6 LARAVAEKEAELSAMTAYRVRHLERLVEEKEVGLREAQHRFERLREDFEYNLGLLRERDAEL 67 L + + KE EL + +R+R LE L+EE+E L ++ R+++L+EDF++NLGL+ +RD EL Sbjct: 161 LRQLIETKERELHEIHDFRLRSLEGLLEEREATLADSFARYDKLKEDFKFNLGLIEDRDVEL 222 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81308.19017.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig81308.19017.1 ID=prot_M-pyrifera_M_contig81308.19017.1|Name=mRNA_M-pyrifera_M_contig81308.19017.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|