mRNA_M-pyrifera_M_contig80502.18861.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80502.18861.1 vs. uniprot
Match: A0A316UVT4_9BASI (WD40 repeat-like protein n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=A0A316UVT4_9BASI) HSP 1 Score: 50.1 bits (118), Expect = 9.950e-5 Identity = 38/106 (35.85%), Postives = 55/106 (51.89%), Query Frame = 1 Query: 13 ADKVVATGCDDGSVVLVGVETGARLPALH-HGESVTHLSFSSSSRYLASGSESL-LKVWDLKHRRGGVPLLEYALSSPLVSVSFDRSQRRVL-AVLESGTALLWEL 321 A + +A D +V + +ET + + L H VT L +SS+ R+L SGS + VWDLK R GG +P+ V+F RVL VLES A++ +L Sbjct: 42 AGQYIAAARADCAVAIYDLETRSLVRFLEGHVRPVTSLDWSSTGRFLVSGSMDWNVVVWDLKKREGGARTRTIRFDAPVSQVTFAPGTSRVLLVVLESQQAIVVDL 147 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80502.18861.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig80502.18861.1 >prot_M-pyrifera_M_contig80502.18861.1 ID=prot_M-pyrifera_M_contig80502.18861.1|Name=mRNA_M-pyrifera_M_contig80502.18861.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bp MFWSADKVVATGCDDGSVVLVGVETGARLPALHHGESVTHLSFSSSSRYLback to top mRNA from alignment at M-pyrifera_M_contig80502:256..585- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig80502.18861.1 ID=mRNA_M-pyrifera_M_contig80502.18861.1|Name=mRNA_M-pyrifera_M_contig80502.18861.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig80502:256..585- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig80502:256..585- >mRNA_M-pyrifera_M_contig80502.18861.1 ID=mRNA_M-pyrifera_M_contig80502.18861.1|Name=mRNA_M-pyrifera_M_contig80502.18861.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=660bp|location=Sequence derived from alignment at M-pyrifera_M_contig80502:256..585- (Macrocystis pyrifera P11B4 male)back to top |