mRNA_M-pyrifera_M_contig79821.18728.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79821.18728.1 vs. uniprot
Match: UPI000C78E68F (zinc finger X-chromosomal protein-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C78E68F) HSP 1 Score: 69.3 bits (168), Expect = 1.370e-11 Identity = 32/82 (39.02%), Postives = 44/82 (53.66%), Query Frame = 1 Query: 1 RCGECGGLFGRKGDLLVHLRNVHLNHRPHACMECDYKAKTGWNLRSHFVRKH-GRKVSVGCNFCGRQVSVLSWRQHLGECHR 243 +C C F K L H+R VH + +C C+Y++ +NLR H R H GRKVS+ C FC + V L W HL + H+ Sbjct: 392 QCDHCEKSFSLKDGLNRHIRAVHFKLKDKSCQHCNYRSAESFNLRMHIARVHEGRKVSLPCPFCNKNVVSLQW--HLEQYHK 471
BLAST of mRNA_M-pyrifera_M_contig79821.18728.1 vs. uniprot
Match: UPI001F4F1D69 (protein bric-a-brac 1-like isoform X1 n=5 Tax=Schistocerca TaxID=7008 RepID=UPI001F4F1D69) HSP 1 Score: 55.8 bits (133), Expect = 7.130e-7 Identity = 21/56 (37.50%), Postives = 33/56 (58.93%), Query Frame = 1 Query: 4 CGECGGLFGRKGDLLVHLRNVHLNHRPHACMECDYKAKTGWNLRSHFVRKHGRKVS 171 C C FG +G+L +H+R+VH + PH C C K K +LR+H R+H + ++ Sbjct: 326 CPYCHRQFGYRGNLTIHIRDVHSHQGPHICPHCGKKMKNKSSLRTHLYRQHNKDLT 381 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79821.18728.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig79821.18728.1 >prot_M-pyrifera_M_contig79821.18728.1 ID=prot_M-pyrifera_M_contig79821.18728.1|Name=mRNA_M-pyrifera_M_contig79821.18728.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=103bp RCGECGGLFGRKGDLLVHLRNVHLNHRPHACMECDYKAKTGWNLRSHFVRback to top mRNA from alignment at M-pyrifera_M_contig79821:6..314+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig79821.18728.1 ID=mRNA_M-pyrifera_M_contig79821.18728.1|Name=mRNA_M-pyrifera_M_contig79821.18728.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=309bp|location=Sequence derived from alignment at M-pyrifera_M_contig79821:6..314+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig79821:6..314+ >mRNA_M-pyrifera_M_contig79821.18728.1 ID=mRNA_M-pyrifera_M_contig79821.18728.1|Name=mRNA_M-pyrifera_M_contig79821.18728.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=618bp|location=Sequence derived from alignment at M-pyrifera_M_contig79821:6..314+ (Macrocystis pyrifera P11B4 male)back to top |