mRNA_M-pyrifera_M_contig79751.18711.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: A0A7S4HLU2_9EUKA (Hypothetical protein n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4HLU2_9EUKA) HSP 1 Score: 69.3 bits (168), Expect = 1.100e-12 Identity = 30/42 (71.43%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSWS 126 HYVTRQPFYLRQM PG M EFK+QGVRFNDL I+ R H ++ Sbjct: 287 HYVTRQPFYLRQMCAPGVMNEFKKQGVRFNDLEIYKRDHRYN 328
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: UPI001E55C5B0 (fatty acid desaturase n=1 Tax=Aquabacterium sp. CECT 9606 TaxID=2845822 RepID=UPI001E55C5B0) HSP 1 Score: 50.8 bits (120), Expect = 4.340e-6 Identity = 20/41 (48.78%), Postives = 28/41 (68.29%), Query Frame = 1 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSW 123 H+V ++PFY+RQM P + GVRFND+G +SRA+ W Sbjct: 291 HFVVKEPFYVRQMTAPVAHRVMREVGVRFNDIGTFSRANRW 331
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: U6ZUL1_9PSED (Fatty acid desaturase n=11 Tax=Pseudomonas TaxID=286 RepID=U6ZUL1_9PSED) HSP 1 Score: 47.8 bits (112), Expect = 5.350e-5 Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 1 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSWSGYE 135 H+V ++PFY+RQM P + GVRFND+G ++RA+ ++ E Sbjct: 291 HFVVKEPFYIRQMTAPVAHRVMAQMGVRFNDMGTFTRANRFAAKE 335
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: M5DUF4_9GAMM (FA_desaturase domain-containing protein n=7 Tax=root TaxID=1 RepID=M5DUF4_9GAMM) HSP 1 Score: 47.8 bits (112), Expect = 5.360e-5 Identity = 18/39 (46.15%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAH 117 H+V R PFY+R + + E ++QG+RFND+G +SRA+ Sbjct: 317 HFVVRDPFYIRHLATKESHEVLRKQGIRFNDMGTFSRAN 355 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig79751.18711.1 >prot_M-pyrifera_M_contig79751.18711.1 ID=prot_M-pyrifera_M_contig79751.18711.1|Name=mRNA_M-pyrifera_M_contig79751.18711.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bp HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSWSGYEback to top mRNA from alignment at M-pyrifera_M_contig79751:827..961- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig79751.18711.1 ID=mRNA_M-pyrifera_M_contig79751.18711.1|Name=mRNA_M-pyrifera_M_contig79751.18711.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=135bp|location=Sequence derived from alignment at M-pyrifera_M_contig79751:827..961- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig79751:827..961- >mRNA_M-pyrifera_M_contig79751.18711.1 ID=mRNA_M-pyrifera_M_contig79751.18711.1|Name=mRNA_M-pyrifera_M_contig79751.18711.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=270bp|location=Sequence derived from alignment at M-pyrifera_M_contig79751:827..961- (Macrocystis pyrifera P11B4 male)back to top |