prot_M-pyrifera_M_contig79751.18711.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: A0A7S4HLU2_9EUKA (Hypothetical protein n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4HLU2_9EUKA) HSP 1 Score: 69.3 bits (168), Expect = 1.100e-12 Identity = 30/42 (71.43%), Postives = 34/42 (80.95%), Query Frame = 0 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSWS 42 HYVTRQPFYLRQM PG M EFK+QGVRFNDL I+ R H ++ Sbjct: 287 HYVTRQPFYLRQMCAPGVMNEFKKQGVRFNDLEIYKRDHRYN 328
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: UPI001E55C5B0 (fatty acid desaturase n=1 Tax=Aquabacterium sp. CECT 9606 TaxID=2845822 RepID=UPI001E55C5B0) HSP 1 Score: 50.8 bits (120), Expect = 4.340e-6 Identity = 20/41 (48.78%), Postives = 28/41 (68.29%), Query Frame = 0 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSW 41 H+V ++PFY+RQM P + GVRFND+G +SRA+ W Sbjct: 291 HFVVKEPFYVRQMTAPVAHRVMREVGVRFNDIGTFSRANRW 331
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: U6ZUL1_9PSED (Fatty acid desaturase n=11 Tax=Pseudomonas TaxID=286 RepID=U6ZUL1_9PSED) HSP 1 Score: 47.8 bits (112), Expect = 5.350e-5 Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 0 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAHSWSGYE 45 H+V ++PFY+RQM P + GVRFND+G ++RA+ ++ E Sbjct: 291 HFVVKEPFYIRQMTAPVAHRVMAQMGVRFNDMGTFTRANRFAAKE 335
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Match: M5DUF4_9GAMM (FA_desaturase domain-containing protein n=7 Tax=root TaxID=1 RepID=M5DUF4_9GAMM) HSP 1 Score: 47.8 bits (112), Expect = 5.360e-5 Identity = 18/39 (46.15%), Postives = 28/39 (71.79%), Query Frame = 0 Query: 1 HYVTRQPFYLRQMIVPGTMEEFKRQGVRFNDLGIWSRAH 39 H+V R PFY+R + + E ++QG+RFND+G +SRA+ Sbjct: 317 HFVVRDPFYIRHLATKESHEVLRKQGIRFNDMGTFSRAN 355 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79751.18711.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig79751.18711.1 ID=prot_M-pyrifera_M_contig79751.18711.1|Name=mRNA_M-pyrifera_M_contig79751.18711.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bpback to top |