prot_M-pyrifera_M_contig78816.18516.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78816.18516.1 vs. uniprot
Match: D7FX52_ECTSI (Importin N-terminal domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX52_ECTSI) HSP 1 Score: 70.1 bits (170), Expect = 6.750e-13 Identity = 32/43 (74.42%), Postives = 41/43 (95.35%), Query Frame = 0 Query: 2 LPHSLRQLLLQLSSVQGDVFDNDEEKKAYASFLVKGATAVLSS 44 LPH+LRQLLLQLSSV GD+F+ND+++KAYASFLV+GA AVL++ Sbjct: 288 LPHALRQLLLQLSSVHGDIFENDDQRKAYASFLVEGAAAVLAA 330
BLAST of mRNA_M-pyrifera_M_contig78816.18516.1 vs. uniprot
Match: A0A6H5K5P3_9PHAE (Importin N-terminal domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5P3_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 6.750e-13 Identity = 32/43 (74.42%), Postives = 41/43 (95.35%), Query Frame = 0 Query: 2 LPHSLRQLLLQLSSVQGDVFDNDEEKKAYASFLVKGATAVLSS 44 LPH+LRQLLLQLSSV GD+F+ND+++KAYASFLV+GA AVL++ Sbjct: 288 LPHALRQLLLQLSSVHGDIFENDDQRKAYASFLVEGAAAVLAA 330 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78816.18516.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78816.18516.1 ID=prot_M-pyrifera_M_contig78816.18516.1|Name=mRNA_M-pyrifera_M_contig78816.18516.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=44bpback to top |