mRNA_M-pyrifera_M_contig76651.18065.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Match: A0A356X295_9BACT (Phage_rep_O domain-containing protein n=2 Tax=Balneolaceae TaxID=1813606 RepID=A0A356X295_9BACT) HSP 1 Score: 62.4 bits (150), Expect = 5.590e-10 Identity = 32/60 (53.33%), Postives = 40/60 (66.67%), Query Frame = 1 Query: 1 MSLKSFEVAFTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIALSTFEKMSG 180 MS K FT PN IDK +P + G+ VLTVI RKTIGF+K+ D+IALS FE ++G Sbjct: 1 MSNKEIGYPFTAYPNYSIDKIMPVIDGNTFKVLTVIVRKTIGFHKKHDKIALSQFEGLTG 60
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Match: A0A2D9FRP3_9BACT (Phage_rep_O domain-containing protein n=1 Tax=Balneola sp. TaxID=2024824 RepID=A0A2D9FRP3_9BACT) HSP 1 Score: 61.6 bits (148), Expect = 9.900e-10 Identity = 30/53 (56.60%), Postives = 41/53 (77.36%), Query Frame = 1 Query: 28 FTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIALSTFEKMSGQA 186 +T++PN I D+ E+ SE+S+L +I RKT GF+K KDRIALSTFEK +G+A Sbjct: 8 YTQMPNKIFDELQAEIGDSELSLLMIIGRKTCGFHKSKDRIALSTFEKFTGKA 60
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Match: A0A2A2GA84_9BACT (Phage_rep_O domain-containing protein n=1 Tax=Aliifodinibius sp. WN023 TaxID=2032627 RepID=A0A2A2GA84_9BACT) HSP 1 Score: 53.1 bits (126), Expect = 1.250e-6 Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 19 EVAFTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIALSTFEKMSGQA 186 E+ +T++PN II+ + EL+G E+ V I RKT GF+K+ D IALS ++G A Sbjct: 7 EIPYTKVPNFIIEDLMAELRGGELKVAIAICRKTFGFHKKTDGIALSQIMDLTGLA 62
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Match: A0A1E7HXY2_9DELT (Uncharacterized protein n=1 Tax=Desulfovibrio sp. S3730MH75 TaxID=1869297 RepID=A0A1E7HXY2_9DELT) HSP 1 Score: 51.2 bits (121), Expect = 5.240e-6 Identity = 20/51 (39.22%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 28 FTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIALSTFEKMSG 180 FT++PN+++D + E+ +E+ ++ RKT G+ K +DRI+ S FEK++G Sbjct: 8 FTQVPNVLLDNQIQEMSKAELKIVLATCRKTFGWQKGRDRISYSQFEKLTG 58
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Match: A0A0F9IXP4_9ZZZZ (Phage_rep_O domain-containing protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9IXP4_9ZZZZ) HSP 1 Score: 50.1 bits (118), Expect = 1.570e-5 Identity = 18/42 (42.86%), Postives = 37/42 (88.10%), Query Frame = 1 Query: 28 FTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIA 153 +T+ PN+IIDKY+ ++ G+E+ V+++I R+T+G++++KDR++ Sbjct: 7 YTQYPNVIIDKYMRDMTGAEIKVISLIVRQTMGWHRDKDRLS 48
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Match: A0A2D8CLX4_9BACT (Phage_rep_O domain-containing protein n=1 Tax=Balneola sp. TaxID=2024824 RepID=A0A2D8CLX4_9BACT) HSP 1 Score: 48.9 bits (115), Expect = 4.140e-5 Identity = 22/58 (37.93%), Postives = 37/58 (63.79%), Query Frame = 1 Query: 7 LKSFEVAFTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIALSTFEKMSG 180 +K E FT+ PN+++D +P + S +L+VI RK+ G+ K+ D I+++ FE SG Sbjct: 1 MKKSEFYFTKFPNVLLDDVMPMVGPSAFKILSVIIRKSKGYQKKGDMISITQFEDNSG 58 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76651.18065.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig76651.18065.1 >prot_M-pyrifera_M_contig76651.18065.1 ID=prot_M-pyrifera_M_contig76651.18065.1|Name=mRNA_M-pyrifera_M_contig76651.18065.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bp MSLKSFEVAFTRIPNIIIDKYLPELQGSEMSVLTVIFRKTIGFNKEKDRIback to top mRNA from alignment at M-pyrifera_M_contig76651:839..1024+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig76651.18065.1 ID=mRNA_M-pyrifera_M_contig76651.18065.1|Name=mRNA_M-pyrifera_M_contig76651.18065.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=186bp|location=Sequence derived from alignment at M-pyrifera_M_contig76651:839..1024+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig76651:839..1024+ >mRNA_M-pyrifera_M_contig76651.18065.1 ID=mRNA_M-pyrifera_M_contig76651.18065.1|Name=mRNA_M-pyrifera_M_contig76651.18065.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=372bp|location=Sequence derived from alignment at M-pyrifera_M_contig76651:839..1024+ (Macrocystis pyrifera P11B4 male)back to top |