mRNA_M-pyrifera_M_contig758.17877.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig758.17877.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 0 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig758.17877.1 >prot_M-pyrifera_M_contig758.17877.1 ID=prot_M-pyrifera_M_contig758.17877.1|Name=mRNA_M-pyrifera_M_contig758.17877.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bp MLDLRFCNRELRPLEKFLRLFQDTMRRVCGPSNMLSRLGQDVNIVMLPQRback to top mRNA from alignment at M-pyrifera_M_contig758:24419..24991+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig758.17877.1 ID=mRNA_M-pyrifera_M_contig758.17877.1|Name=mRNA_M-pyrifera_M_contig758.17877.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=573bp|location=Sequence derived from alignment at M-pyrifera_M_contig758:24419..24991+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig758:24419..24991+ >mRNA_M-pyrifera_M_contig758.17877.1 ID=mRNA_M-pyrifera_M_contig758.17877.1|Name=mRNA_M-pyrifera_M_contig758.17877.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=624bp|location=Sequence derived from alignment at M-pyrifera_M_contig758:24419..24991+ (Macrocystis pyrifera P11B4 male)back to top |