prot_M-pyrifera_M_contig75553.17819.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75553.17819.1 vs. uniprot
Match: D7FHI0_ECTSI (LisH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHI0_ECTSI) HSP 1 Score: 107 bits (267), Expect = 8.950e-26 Identity = 55/57 (96.49%), Postives = 57/57 (100.00%), Query Frame = 0 Query: 1 ESYSQLREAAKQIIARVAGRLSGTVGRSGLMDPAVTGLERAAVVANTPITFRPRELL 57 E+YSQLREAAKQIIARVAGRLSGTVG+SGLMDPAVTGLERAAVVANTPITFRPRELL Sbjct: 1198 ETYSQLREAAKQIIARVAGRLSGTVGKSGLMDPAVTGLERAAVVANTPITFRPRELL 1254
BLAST of mRNA_M-pyrifera_M_contig75553.17819.1 vs. uniprot
Match: A0A6H5JDL7_9PHAE (LisH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDL7_9PHAE) HSP 1 Score: 102 bits (255), Expect = 3.750e-24 Identity = 53/57 (92.98%), Postives = 56/57 (98.25%), Query Frame = 0 Query: 1 ESYSQLREAAKQIIARVAGRLSGTVGRSGLMDPAVTGLERAAVVANTPITFRPRELL 57 E+YS+LREAAKQIIARVAGRLSGTVG+SGLMDPAVTGLERAAVVANTPITFR RELL Sbjct: 1236 ETYSKLREAAKQIIARVAGRLSGTVGKSGLMDPAVTGLERAAVVANTPITFRSRELL 1292 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75553.17819.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75553.17819.1 ID=prot_M-pyrifera_M_contig75553.17819.1|Name=mRNA_M-pyrifera_M_contig75553.17819.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bpback to top |