Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR013049 | Spo11/DNA topoisomerase VI, subunit A, N-terminal | PFAM | PF04406 | TP6A_N | coord: 22..81 e-value: 7.9E-16 score: 57.8 |
IPR036388 | Winged helix-like DNA-binding domain superfamily | GENE3D | 1.10.10.10 | | coord: 16..84 e-value: 1.2E-5 score: 27.0 |
None | No IPR available | PANTHER | PTHR10848:SF0 | MEIOTIC RECOMBINATION PROTEIN SPO11 | coord: 19..87 |
IPR002815 | Spo11/DNA topoisomerase VI subunit A | PANTHER | PTHR10848 | MEIOTIC RECOMBINATION PROTEIN SPO11 | coord: 19..87 |
IPR036078 | Spo11/DNA topoisomerase VI subunit A superfamily | SUPERFAMILY | 56726 | DNA topoisomerase IV, alpha subunit | coord: 21..87 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75332.17781.1 ID=prot_M-pyrifera_M_contig75332.17781.1|Name=mRNA_M-pyrifera_M_contig75332.17781.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=87bp MLSPASLWEPSTVRRFLNRSKSLAALWSVLKSSHSLLHGKKSATLREAYY MDAALFSKQEDTNRAVQQVCGMLHIPRHSLGFMASAR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|