prot_M-pyrifera_M_contig75039.17727.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75039.17727.1 vs. uniprot
Match: A0A6H5KC52_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KC52_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 1.150e-18 Identity = 38/46 (82.61%), Postives = 45/46 (97.83%), Query Frame = 0 Query: 1 LGRGYIDRELLKARQAQRYFLHTVTPAAVLIQSQWRGYTKRRDLAE 46 +GRGYIDREL+KAR+AQR+FLHT+TPA VLIQSQWRGYT+RRDLA+ Sbjct: 1376 VGRGYIDRELVKARRAQRHFLHTITPACVLIQSQWRGYTRRRDLAK 1421
BLAST of mRNA_M-pyrifera_M_contig75039.17727.1 vs. uniprot
Match: D7FMH0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMH0_ECTSI) HSP 1 Score: 85.5 bits (210), Expect = 2.940e-18 Identity = 37/46 (80.43%), Postives = 45/46 (97.83%), Query Frame = 0 Query: 1 LGRGYIDRELLKARQAQRYFLHTVTPAAVLIQSQWRGYTKRRDLAE 46 +GRGYIDREL+KAR++QR+FLHT+TPA VLIQSQWRGYT+RRDLA+ Sbjct: 1346 VGRGYIDRELVKARRSQRHFLHTITPACVLIQSQWRGYTRRRDLAK 1391 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75039.17727.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75039.17727.1 ID=prot_M-pyrifera_M_contig75039.17727.1|Name=mRNA_M-pyrifera_M_contig75039.17727.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=47bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|