prot_M-pyrifera_M_contig74832.17689.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74832.17689.1 vs. uniprot
Match: A0A6H5JKE3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKE3_9PHAE) HSP 1 Score: 91.7 bits (226), Expect = 1.260e-21 Identity = 41/55 (74.55%), Postives = 47/55 (85.45%), Query Frame = 0 Query: 1 MPEDYPKKWLTFCAEGSLDAIEAFLGSAGKPLVALMSLRGALQVGYPQFVEMIAS 55 MPE YPK W TFC EG + +IEAFLGS GKPLVAL+SLRGALQVGYP FV+MI++ Sbjct: 157 MPETYPKNWTTFCVEGKMTSIEAFLGSKGKPLVALLSLRGALQVGYPHFVQMIST 211 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74832.17689.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74832.17689.1 ID=prot_M-pyrifera_M_contig74832.17689.1|Name=mRNA_M-pyrifera_M_contig74832.17689.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bpback to top |