mRNA_M-pyrifera_M_contig74832.17689.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74832.17689.1 vs. uniprot
Match: A0A6H5JKE3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKE3_9PHAE) HSP 1 Score: 104 bits (259), Expect = 2.000e-26 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1 Query: 1 EVTVTFPEMPEDYPKKWLTFCAEGSLDAIEAFLGSAGKPLVALMSLRGALQVGYPQFVEMIAS 189 EV+V+FPEMPE YPK W TFC EG + +IEAFLGS GKPLVAL+SLRGALQVGYP FV+MI++ Sbjct: 149 EVSVSFPEMPETYPKNWTTFCVEGKMTSIEAFLGSKGKPLVALLSLRGALQVGYPHFVQMIST 211 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74832.17689.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74832.17689.1 >prot_M-pyrifera_M_contig74832.17689.1 ID=prot_M-pyrifera_M_contig74832.17689.1|Name=mRNA_M-pyrifera_M_contig74832.17689.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=56bp MPEDYPKKWLTFCAEGSLDAIEAFLGSAGKPLVALMSLRGALQVGYPQFVback to top mRNA from alignment at M-pyrifera_M_contig74832:191..382+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74832.17689.1 ID=mRNA_M-pyrifera_M_contig74832.17689.1|Name=mRNA_M-pyrifera_M_contig74832.17689.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=192bp|location=Sequence derived from alignment at M-pyrifera_M_contig74832:191..382+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74832:191..382+ >mRNA_M-pyrifera_M_contig74832.17689.1 ID=mRNA_M-pyrifera_M_contig74832.17689.1|Name=mRNA_M-pyrifera_M_contig74832.17689.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig74832:191..382+ (Macrocystis pyrifera P11B4 male)back to top |