Homology
BLAST of mRNA_M-pyrifera_M_contig74708.17671.1 vs. uniprot
Match:
A0A7W1JM88_9BACT (Tetratricopeptide repeat protein n=1 Tax=Armatimonadetes bacterium TaxID=2033014 RepID=A0A7W1JM88_9BACT)
HSP 1 Score: 49.3 bits (116), Expect = 4.340e-5
Identity = 25/79 (31.65%), Postives = 42/79 (53.16%), Query Frame = 0
Query: 20 MDEDDFEHLMQEAIDAGSKGDLQRALPLFRRLAELDSENSAAWTNLGVTEMRAGHTEAAQEAYDRAMDLAPWDVTPRFN 98
M D + L+ +A D + + ++A + R+ E+D+ NS A+ LGV R G E A +A+ RA+ AP+ +N
Sbjct: 1 MSTDQVKQLITDASDHVREQNFEKAAEIARQALEVDTRNSDAYGVLGVAFARLGRIEEATDAFQRAVQTAPYSARSYYN 79
The following BLAST results are available for this feature:
InterPro
Analysis Name:
InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
M C H T I F L S V L L C V F V V V G A M D E D D F E H L M Q E A I D A G S K G D L Q R A L P L F R R L A E L D S E N S A A W T N L G V T E M R A G H T E A A Q E A Y D R A M D L A P W D V T P R F N 10 20 30 40 50 60 70 80 90 Expect = 7.6E-16 / Score = 60.0 Score = Expect = 5.8E-7 / Score = 29.9 Score = Score = Score = Score = Score = Score = 0.864 Score = 5.782 Score = 10.679 Score = 14.212 Sequence G3DSA:1.25.40.10 SSF48452 PF14559 SIGNAL_PEPTIDE_C_REGION SIGNAL_PEPTIDE NON_CYTOPLASMIC_DOMAIN SIGNAL_PEPTIDE_H_REGION SIGNAL_PEPTIDE_N_REGION SignalP-noTM PS50005 PS50005 PS50293
IPR Term IPR Description Source Source Term Source Description Alignment
IPR011990 Tetratricopeptide-like helical domain superfamily GENE3D 1.25.40.10 coord: 16..98 e-value: 7.6E-16 score: 60.0
IPR011990 Tetratricopeptide-like helical domain superfamily SUPERFAMILY 48452 TPR-like coord: 20..97
None No IPR available PFAM PF14559 TPR_19 coord: 39..90 e-value: 5.8E-7 score: 29.9
None No IPR available PHOBIUS SIGNAL_PEPTIDE_C_REGION Signal peptide C-region coord: 16..19
None No IPR available PHOBIUS SIGNAL_PEPTIDE Signal Peptide coord: 1..19
None No IPR available PHOBIUS NON_CYTOPLASMIC_DOMAIN Non cytoplasmic domain coord: 20..98
None No IPR available PHOBIUS SIGNAL_PEPTIDE_H_REGION Signal peptide H-region coord: 4..15
None No IPR available PHOBIUS SIGNAL_PEPTIDE_N_REGION Signal peptide N-region coord: 1..3
None No IPR available SIGNALP_EUK SignalP-noTM SignalP-noTM coord: 1..19 score: 0.864
IPR019734 Tetratricopeptide repeat PROSITE PS50005 TPR coord: 25..58 score: 5.782
IPR019734 Tetratricopeptide repeat PROSITE PS50005 TPR coord: 59..92 score: 10.679
IPR013026 Tetratricopeptide repeat-containing domain PROSITE PS50293 TPR_REGION coord: 25..92 score: 14.212
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>prot_M-pyrifera_M_contig74708.17671.1 ID=prot_M-pyrifera_M_contig74708.17671.1|Name=mRNA_M-pyrifera_M_contig74708.17671.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=98bp MCHTIFLSVLLCVFVVVGAMDEDDFEHLMQEAIDAGSKGDLQRALPLFRR LAELDSENSAAWTNLGVTEMRAGHTEAAQEAYDRAMDLAPWDVTPRFN back to top
Annotated Terms
The following terms have been associated with this polypeptide: