prot_M-pyrifera_M_contig100821.176.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100821.176.1 vs. uniprot
Match: UPI001E6747E3 (uncharacterized protein LOC123763147 n=1 Tax=Procambarus clarkii TaxID=6728 RepID=UPI001E6747E3) HSP 1 Score: 59.3 bits (142), Expect = 5.670e-8 Identity = 32/83 (38.55%), Postives = 40/83 (48.19%), Query Frame = 0 Query: 17 CPFYHTLLDGRRSPLHFTYSNQRCSDAPSDDKGKCSKGAMCPMAHNDCEHFYHPDFVRKSVCMYADNPSQC--KGPLCSFMHP 97 C YH LLD RRSP + YS++ C + KC+K CP AH E YH R VC + C K +C F+HP Sbjct: 3959 CSGYHNLLDRRRSPGFYEYSDEMCRAVIQ--RTKCAKQDSCPYAHTTVERDYHVKRFRSLVCPGRNKAHFCSKKKEVCPFVHP 4039 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100821.176.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100821.176.1 ID=prot_M-pyrifera_M_contig100821.176.1|Name=mRNA_M-pyrifera_M_contig100821.176.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=107bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|