prot_M-pyrifera_M_contig72436.17223.1 (polypeptide) Macrocystis pyrifera P11B4 male
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A2H1FYG3_ZYMTR (USP domain-containing protein n=3 Tax=Zymoseptoria tritici TaxID=1047171 RepID=A0A2H1FYG3_ZYMTR) HSP 1 Score: 49.7 bits (117), Expect = 1.400e-5 Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTMLH 35 +G++NRGN CY NAV+QAL H FYR L M+H Sbjct: 368 KGLQNRGNDCYRNAVLQALFHIPAFYRYLGMIH 400
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: UPI001B88C5C9 (ubiquitin carboxyl-terminal hydrolase 10-like n=1 Tax=Gigantopelta aegis TaxID=1735272 RepID=UPI001B88C5C9) HSP 1 Score: 49.7 bits (117), Expect = 1.400e-5 Identity = 25/49 (51.02%), Postives = 29/49 (59.18%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTMLHGIRL----PVCCPVTD 47 RG+ NRGN CY NA +QAL+ C PFY LL L RL P P+ D Sbjct: 403 RGLVNRGNWCYINATLQALVACPPFYHLLKKLSTARLLTRGPSSTPILD 451
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: R7T7D9_CAPTE (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Capitella teleta TaxID=283909 RepID=R7T7D9_CAPTE) HSP 1 Score: 49.3 bits (116), Expect = 1.900e-5 Identity = 25/51 (49.02%), Postives = 29/51 (56.86%), Query Frame = 0 Query: 1 MERGIENRGNSCYANAVMQALLHCGPFYRLLTMLHGI----RLPVCCPVTD 47 M RG+ N+GN CY NA +QALL C PFY L+ L R P PV D Sbjct: 1 MPRGLHNKGNWCYVNATLQALLACPPFYHLMKSLPDFPALARGPSSTPVID 51
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A1Y2G6D9_9FUNG (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2G6D9_9FUNG) HSP 1 Score: 49.3 bits (116), Expect = 1.910e-5 Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTML 34 RG+ N GN C+ NA++Q LLHC PFY LLT + Sbjct: 147 RGLVNNGNMCFMNAILQPLLHCPPFYNLLTQI 178
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A517KXB6_9PEZI (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Venturia effusa TaxID=50376 RepID=A0A517KXB6_9PEZI) HSP 1 Score: 49.3 bits (116), Expect = 1.920e-5 Identity = 19/32 (59.38%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTML 34 RG+EN GN CY N+V+QAL+HC PFY L ++ Sbjct: 464 RGLENTGNMCYMNSVLQALVHCVPFYEFLEII 495
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A443SNR0_9ACAR (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Leptotrombidium deliense TaxID=299467 RepID=A0A443SNR0_9ACAR) HSP 1 Score: 48.9 bits (115), Expect = 2.630e-5 Identity = 23/49 (46.94%), Postives = 29/49 (59.18%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTMLHGI----RLPVCCPVTD 47 RG NRGN CY NA +QALL+C PFY L+ + + R C P+ D Sbjct: 484 RGFVNRGNWCYINATLQALLYCPPFYNLMREIGEVSGICREKSCTPIID 532
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A1Y3B9Q9_EURMA (UCH domain-containing protein n=1 Tax=Euroglyphus maynei TaxID=6958 RepID=A0A1Y3B9Q9_EURMA) HSP 1 Score: 47.8 bits (112), Expect = 3.200e-5 Identity = 26/53 (49.06%), Postives = 31/53 (58.49%), Query Frame = 0 Query: 1 MERGIENRGNSCYANAVMQALLHCGPFYRLLTMLH---GI-RLPVCCPVTDRL 49 M RG+ NRGN CY NA +QALL C PFY L+ + GI R P+ D L Sbjct: 109 MPRGLINRGNWCYVNATLQALLACPPFYNLMREISETPGIFRQSTSTPIIDNL 161
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A4S4KA93_9APHY (USP domain-containing protein n=1 Tax=Hermanssonia centrifuga TaxID=98765 RepID=A0A4S4KA93_9APHY) HSP 1 Score: 48.5 bits (114), Expect = 3.590e-5 Identity = 20/32 (62.50%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTML 34 RG+ N GN C+ANAV+Q L++C PFYRL T L Sbjct: 374 RGLVNTGNMCFANAVLQVLVYCPPFYRLFTEL 405
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: A0A2R6NMX7_9APHY (USP domain-containing protein n=1 Tax=Hermanssonia centrifuga TaxID=98765 RepID=A0A2R6NMX7_9APHY) HSP 1 Score: 48.5 bits (114), Expect = 3.600e-5 Identity = 20/32 (62.50%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTML 34 RG+ N GN C+ANAV+Q L++C PFYRL T L Sbjct: 488 RGLVNTGNMCFANAVLQVLVYCPPFYRLFTEL 519
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Match: UPI001904B3C6 (uncharacterized protein n=1 Tax=Cantharellus anzutake TaxID=1750568 RepID=UPI001904B3C6) HSP 1 Score: 48.1 bits (113), Expect = 4.910e-5 Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 3 RGIENRGNSCYANAVMQALLHCGPFYRLLTMLHGIRLP 40 RG+ N GN C+AN V+QALLH PFY+L M+ G LP Sbjct: 344 RGLVNSGNMCFANVVLQALLHTAPFYKLFDMI-GRTLP 380 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72436.17223.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 21 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72436.17223.1 ID=prot_M-pyrifera_M_contig72436.17223.1|Name=mRNA_M-pyrifera_M_contig72436.17223.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=50bpback to top |