mRNA_M-pyrifera_M_contig72309.17193.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72309.17193.1 vs. uniprot
Match: A0A6B1AYI3_9ACTN (SAF domain-containing protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A6B1AYI3_9ACTN) HSP 1 Score: 85.1 bits (209), Expect = 1.080e-17 Identity = 51/114 (44.74%), Postives = 65/114 (57.02%), Query Frame = 1 Query: 94 SVDRLRREWQPIAPSWVITRPLEAGHVVEPGDVEARTLPPAALPSDAVEGSPVGRRLADSVATGEIVRNGRLDVAGATANASRIGDRRGALTLPSPTPHLEPGDRVDLYALLDG 435 S R +WQ WV+T LEAG + D+ + LP A P DA G P G L DS+ATGEIVR+GRL A A A+++G+ G LT+ + L GD VDLY L+DG Sbjct: 51 SAATARAQWQTEIDGWVVTGDLEAGTTLTADDLASTRLPAAGTPHDATTGDPNGFTLRDSMATGEIVRDGRLTTA-AGPLAAQLGEAAGGLTIATDGTPLGAGDLVDLYGLIDG 163 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72309.17193.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig72309.17193.1 >prot_M-pyrifera_M_contig72309.17193.1 ID=prot_M-pyrifera_M_contig72309.17193.1|Name=mRNA_M-pyrifera_M_contig72309.17193.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=145bp VARLRHHRRGRAALAALLILGSLLMLSAERASVDRLRREWQPIAPSWVITback to top mRNA from alignment at M-pyrifera_M_contig72309:693..1127+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig72309.17193.1 ID=mRNA_M-pyrifera_M_contig72309.17193.1|Name=mRNA_M-pyrifera_M_contig72309.17193.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=435bp|location=Sequence derived from alignment at M-pyrifera_M_contig72309:693..1127+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig72309:693..1127+ >mRNA_M-pyrifera_M_contig72309.17193.1 ID=mRNA_M-pyrifera_M_contig72309.17193.1|Name=mRNA_M-pyrifera_M_contig72309.17193.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=870bp|location=Sequence derived from alignment at M-pyrifera_M_contig72309:693..1127+ (Macrocystis pyrifera P11B4 male)back to top |