prot_M-pyrifera_M_contig7157.17057.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7157.17057.1 vs. uniprot
Match: A0A6H5JZE4_9PHAE (Sulfotransfer_1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JZE4_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 9.100e-9 Identity = 25/37 (67.57%), Postives = 33/37 (89.19%), Query Frame = 0 Query: 1 VTPEILESLTEFFAPHNTRLQELLGRPLPDSWTTSTT 37 VTPEIL+S+ +FFAP NT+L+ELLGRPLPD+W+ +T Sbjct: 411 VTPEILQSMRDFFAPFNTQLEELLGRPLPDNWSKDST 447
BLAST of mRNA_M-pyrifera_M_contig7157.17057.1 vs. uniprot
Match: D7G7A7_ECTSI (Sulfotransfer_1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7A7_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 4.110e-8 Identity = 23/34 (67.65%), Postives = 30/34 (88.24%), Query Frame = 0 Query: 1 VTPEILESLTEFFAPHNTRLQELLGRPLPDSWTT 34 VTPE+L+S+ +FFA HN L+ELLGRPLPD+W+T Sbjct: 279 VTPELLQSMRDFFASHNAELEELLGRPLPDNWST 312 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7157.17057.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7157.17057.1 ID=prot_M-pyrifera_M_contig7157.17057.1|Name=mRNA_M-pyrifera_M_contig7157.17057.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bpback to top |