mRNA_M-pyrifera_M_contig7157.17057.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7157.17057.1 vs. uniprot
Match: A0A6H5JZE4_9PHAE (Sulfotransfer_1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JZE4_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 9.100e-9 Identity = 25/37 (67.57%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 1 VTPEILESLTEFFAPHNTRLQELLGRPLPDSWTTSTT 111 VTPEIL+S+ +FFAP NT+L+ELLGRPLPD+W+ +T Sbjct: 411 VTPEILQSMRDFFAPFNTQLEELLGRPLPDNWSKDST 447
BLAST of mRNA_M-pyrifera_M_contig7157.17057.1 vs. uniprot
Match: D7G7A7_ECTSI (Sulfotransfer_1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7A7_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 4.110e-8 Identity = 23/34 (67.65%), Postives = 30/34 (88.24%), Query Frame = 1 Query: 1 VTPEILESLTEFFAPHNTRLQELLGRPLPDSWTT 102 VTPE+L+S+ +FFA HN L+ELLGRPLPD+W+T Sbjct: 279 VTPELLQSMRDFFASHNAELEELLGRPLPDNWST 312 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7157.17057.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7157.17057.1 >prot_M-pyrifera_M_contig7157.17057.1 ID=prot_M-pyrifera_M_contig7157.17057.1|Name=mRNA_M-pyrifera_M_contig7157.17057.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bp VTPEILESLTEFFAPHNTRLQELLGRPLPDSWTTSTTAG*back to top mRNA from alignment at M-pyrifera_M_contig7157:5375..5494- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7157.17057.1 ID=mRNA_M-pyrifera_M_contig7157.17057.1|Name=mRNA_M-pyrifera_M_contig7157.17057.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=120bp|location=Sequence derived from alignment at M-pyrifera_M_contig7157:5375..5494- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7157:5375..5494- >mRNA_M-pyrifera_M_contig7157.17057.1 ID=mRNA_M-pyrifera_M_contig7157.17057.1|Name=mRNA_M-pyrifera_M_contig7157.17057.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig7157:5375..5494- (Macrocystis pyrifera P11B4 male)back to top |