prot_M-pyrifera_M_contig7080.16901.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7080.16901.1 vs. uniprot
Match: A0A6H5L6L5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6L5_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 7.370e-8 Identity = 26/35 (74.29%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 1 FLRNSSVARASFLGYLLLLHLWAFAVLGFHHSNME 35 FLRNSSVARA+FL YLLLLHLW FAV+G H S + Sbjct: 900 FLRNSSVARAAFLAYLLLLHLWTFAVVGLHSSTLN 934
BLAST of mRNA_M-pyrifera_M_contig7080.16901.1 vs. uniprot
Match: D8LSA0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSA0_ECTSI) HSP 1 Score: 50.4 bits (119), Expect = 4.320e-6 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 1 FLRNSSVARASFLGYLLLLHLWAFAVLGFHHSNME 35 FLRNSSVARA+FL YLLLLHL AFA++G H S + Sbjct: 861 FLRNSSVARAAFLAYLLLLHLSAFALVGLHSSTLN 895
BLAST of mRNA_M-pyrifera_M_contig7080.16901.1 vs. uniprot
Match: A0A024UK16_9STRA (Uncharacterized protein n=4 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024UK16_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 3.890e-5 Identity = 21/38 (55.26%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 1 FLRNSSVARASFLGYLLLLHLWAFAVLGFHHSNMEQPI 38 FLR AR + LGYL+LLHLWAF +LGFH S++ + + Sbjct: 546 FLRAYPEARLALLGYLVLLHLWAFVILGFHTSHLNEEV 583
BLAST of mRNA_M-pyrifera_M_contig7080.16901.1 vs. uniprot
Match: A0A397D1J3_9STRA (Uncharacterized protein n=3 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A397D1J3_9STRA) HSP 1 Score: 46.6 bits (109), Expect = 9.950e-5 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0 Query: 1 FLRNSSVARASFLGYLLLLHLWAFAVLGFHHSNMEQPI 38 FLR AR LGYL+LLHLWAF +LGFH S++ + Sbjct: 758 FLRAYPEARLGLLGYLVLLHLWAFVILGFHTSHLSDEV 795
BLAST of mRNA_M-pyrifera_M_contig7080.16901.1 vs. uniprot
Match: W4H6P5_9STRA (Uncharacterized protein n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4H6P5_9STRA) HSP 1 Score: 46.6 bits (109), Expect = 9.980e-5 Identity = 21/38 (55.26%), Postives = 26/38 (68.42%), Query Frame = 0 Query: 1 FLRNSSVARASFLGYLLLLHLWAFAVLGFHHSNMEQPI 38 FLR AR LGYL+LLHLWAF +LGFH S++ + Sbjct: 519 FLRAYPEARLGLLGYLVLLHLWAFVILGFHTSHLSDEV 556 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7080.16901.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7080.16901.1 ID=prot_M-pyrifera_M_contig7080.16901.1|Name=mRNA_M-pyrifera_M_contig7080.16901.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bpback to top |