prot_M-pyrifera_M_contig100749.168.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100749.168.1 vs. uniprot
Match: A0A7C1WH59_9BACT (Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A7C1WH59_9BACT) HSP 1 Score: 63.2 bits (152), Expect = 1.450e-9 Identity = 41/133 (30.83%), Postives = 68/133 (51.13%), Query Frame = 0 Query: 1 MVYEHHTEVLPASAVRGFAQFQEGFMTLIL----HARSLDGDNDMLS-QAGLHRFQITDTGILQTATSMGHSSFNED-AENIWEEPNTPREFRISLNLDDLTLTNPDGSRFIFRRIGAQPYPLEATEKIRAAR 127 +V++ EV+ RG+AQF +G+ TLIL R GD+ + +G +R++I ++G LQ ++ +G + +E A + P+ RE+ I L + L L P G F FRR+ + E +R R Sbjct: 55 LVFDTPEEVVEPEDFRGYAQFHDGYCTLILIGAEPVRDFFGDDTAYTFLSGAYRYRIGESGTLQLSSVVGFDNLDEPGALSFHTGPDATREYEIQLTDNSLRLREPGGDTFEFRRLPKSTFSSHDLESLRLQR 187 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100749.168.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100749.168.1 ID=prot_M-pyrifera_M_contig100749.168.1|Name=mRNA_M-pyrifera_M_contig100749.168.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=133bpback to top |