prot_M-pyrifera_M_contig100619.138.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100619.138.1 vs. uniprot
Match: A0A7C3E8Q0_9DELT (PaaI family thioesterase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A7C3E8Q0_9DELT) HSP 1 Score: 65.9 bits (159), Expect = 6.070e-12 Identity = 33/60 (55.00%), Postives = 43/60 (71.67%), Query Frame = 0 Query: 1 MRIDYFEPILGPTFIIESKVEKHRGRTVFVATQFFQ-DGELAVHALTTMREIQAPKTLGD 59 MR+DYFEPI+GP F+IESK+ K RGRT V T+F+ + LAV A T +RE+ + LGD Sbjct: 101 MRLDYFEPIVGPEFVIESKLVKARGRTRAVETRFYDPEDTLAVFAFTLIREMPLDRVLGD 160
BLAST of mRNA_M-pyrifera_M_contig100619.138.1 vs. uniprot
Match: A0A2H5ZIH1_9BACT (4HBT domain-containing protein n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZIH1_9BACT) HSP 1 Score: 65.5 bits (158), Expect = 8.560e-12 Identity = 34/60 (56.67%), Postives = 43/60 (71.67%), Query Frame = 0 Query: 1 MRIDYFEPILGPTFIIESKVEKHRGRTVFVATQFFQ-DGELAVHALTTMREIQAPKTLGD 59 MRIDYFEPI+GP F+IESK+ K RGRT V T+F+ + LAV A T +RE+ + LGD Sbjct: 101 MRIDYFEPIVGPHFLIESKLAKARGRTRAVETRFYDPEDTLAVFAFTLIREMPLGRPLGD 160
BLAST of mRNA_M-pyrifera_M_contig100619.138.1 vs. uniprot
Match: A0A523II92_9DELT (PaaI family thioesterase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A523II92_9DELT) HSP 1 Score: 63.5 bits (153), Expect = 4.250e-11 Identity = 32/61 (52.46%), Postives = 39/61 (63.93%), Query Frame = 0 Query: 1 MRIDYFEPILGPTFIIESKVEKHRGRTVFVATQFFQ-DGELAVHALTTMREIQAPKTLGDA 60 MR+DYFEP+ GP F I+S + RGR FV T+F D +L V ALTT+R I LGDA Sbjct: 95 MRVDYFEPVTGPRFFIQSTLVNQRGRMYFVETRFLNVDDKLLVFALTTLRRIPMTGALGDA 155 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100619.138.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100619.138.1 ID=prot_M-pyrifera_M_contig100619.138.1|Name=mRNA_M-pyrifera_M_contig100619.138.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=63bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|