prot_M-pyrifera_M_contig100559.126.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100559.126.1 vs. uniprot
Match: A0A067CU98_SAPPC (Trafficking protein particle complex subunit 2-like protein n=3 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067CU98_SAPPC) HSP 1 Score: 64.7 bits (156), Expect = 3.330e-11 Identity = 27/74 (36.49%), Postives = 51/74 (68.92%), Query Frame = 0 Query: 12 KVFGYVPSTGIRLFLITRELPLRESALRALLAEVHRVYADTISNPFCAPDAPITSERFKKRLDDLFTKAVQTLE 85 +V+GYV +T ++L ++ ++ P++ES +R L AE+H++Y + +SNPF ITSE+F+ ++ +L + T+E Sbjct: 62 RVYGYVTNTLVKLVVVVQDAPIKESEMRVLFAELHKLYVNAMSNPFAIIGERITSEKFESKVYNLILQHNHTIE 135
BLAST of mRNA_M-pyrifera_M_contig100559.126.1 vs. uniprot
Match: A0A484EFD6_BRELC (Trafficking protein particle complex subunit 2-like protein n=1 Tax=Bremia lactucae TaxID=4779 RepID=A0A484EFD6_BRELC) HSP 1 Score: 63.2 bits (152), Expect = 1.380e-10 Identity = 28/76 (36.84%), Postives = 48/76 (63.16%), Query Frame = 0 Query: 1 FVNILLTHELQKVFGYVPSTGIRLFLITRELPLRESALRALLAEVHRVYADTISNPFCAPDAPITSERFKKRLDDL 76 ++ L T E +V+GYV +T I+ ++ ++ P+RES LR L E+HR+Y + +SNPF +TS+ F K++ + Sbjct: 57 YLGFLGTIEDYRVYGYVTNTSIKFVVVLQDAPVRESELRPLFLEIHRLYVNAMSNPFAPLGERLTSQTFDKQVSHI 132
BLAST of mRNA_M-pyrifera_M_contig100559.126.1 vs. uniprot
Match: M4B9A4_HYAAE (Uncharacterized protein n=2 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4B9A4_HYAAE) HSP 1 Score: 61.6 bits (148), Expect = 1.550e-10 Identity = 27/68 (39.71%), Postives = 46/68 (67.65%), Query Frame = 0 Query: 9 ELQKVFGYVPSTGIRLFLITRELPLRESALRALLAEVHRVYADTISNPFCAPDAPITSERFKKRLDDL 76 E +V+GYV ++ ++ ++ ++ P+RE LR+LLAEVH +Y + +SNPF +TS+ F KR+ +L Sbjct: 10 EDYRVYGYVTNSSVKFVVLLQDAPVREVELRSLLAEVHHLYVNAMSNPFTPLGERLTSQMFDKRVSNL 77
BLAST of mRNA_M-pyrifera_M_contig100559.126.1 vs. uniprot
Match: A0A1V9Y706_9STRA (Trafficking protein particle complex subunit 2-like protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9Y706_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 2.770e-9 Identity = 26/77 (33.77%), Postives = 50/77 (64.94%), Query Frame = 0 Query: 9 ELQKVFGYVPSTGIRLFLITRELPLRESALRALLAEVHRVYADTISNPFCAPDAPITSERFKKRLDDLFTKAVQTLE 85 E +V+GYV +T +++ ++ ++ P++ES +R L E+H++Y + +SNPF I SE+F+K++ +L + LE Sbjct: 74 EDYRVYGYVTNTLVKIIVVVQDAPIKESEMRNLFTELHKLYVNAMSNPFAIIGERIKSEKFEKKVYNLVLQHNHMLE 150 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100559.126.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100559.126.1 ID=prot_M-pyrifera_M_contig100559.126.1|Name=mRNA_M-pyrifera_M_contig100559.126.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=93bpback to top |