prot_M-pyrifera_M_contig100504.105.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100504.105.1 vs. uniprot
Match: A0A7S4HU27_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4HU27_9EUKA) HSP 1 Score: 68.6 bits (166), Expect = 1.810e-11 Identity = 39/84 (46.43%), Postives = 51/84 (60.71%), Query Frame = 0 Query: 1 ETKRSAERGEIVLQKQMMIRGLDLNLVHPNRYFVNMGHLVRMTKD-GAPENRTFFLFNDMLLATKPDPHSKLFNYDGYVLIRGA 83 E KR +E V Q IRG+ +N+VHP R + G L R+ + GA E R F+L +DM+L+T P KL YDGY+LIRGA Sbjct: 135 ERKRESENMGKVATIQQTIRGIGMNIVHPQRRLLKRGQLTRVNAETGAHETRYFYLLSDMMLSTIPT-EDKLRIYDGYILIRGA 217 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100504.105.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100504.105.1 ID=prot_M-pyrifera_M_contig100504.105.1|Name=mRNA_M-pyrifera_M_contig100504.105.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=132bpback to top |