mRNA_M-pyrifera_M_contig10047.98.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10047.98.1 vs. uniprot
Match: A0A6H5K108_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K108_9PHAE) HSP 1 Score: 85.5 bits (210), Expect = 1.290e-17 Identity = 48/84 (57.14%), Postives = 56/84 (66.67%), Query Frame = 1 Query: 1 QEVCTTYGDMDNAKRLFSFGFVTLSQHGQRSVSPFDR------LSLPTESFCDVSFPAVSTDPLLDFKESVIQECGREAEDGVS 234 +EVCTTYGDMDNAKRLFSFGFVTL QH + PF R L+LPTE+FCDV +TD L KE+V +E R A D +S Sbjct: 344 EEVCTTYGDMDNAKRLFSFGFVTLKQH---AAQPFQRRLTGNMLALPTEAFCDVELTIAATDALRVVKETVFRE--RRAGDDLS 422
BLAST of mRNA_M-pyrifera_M_contig10047.98.1 vs. uniprot
Match: D7G231_ECTSI (SET domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G231_ECTSI) HSP 1 Score: 84.0 bits (206), Expect = 4.480e-17 Identity = 50/85 (58.82%), Postives = 58/85 (68.24%), Query Frame = 1 Query: 1 QEVCTTYGDMDNAKRLFSFGFVTLSQHGQRSVSPFDR------LSLPTESFCDVSFPAVSTDPLLDFKESVIQECGREA-EDGVS 234 +EVCTTYGDMDNAKRLFSFGFVTL QH + P R L LPTE+FCDV +TD L FKE+V++E R+A ED VS Sbjct: 344 EEVCTTYGDMDNAKRLFSFGFVTLKQH---AAQPSQRRPAGNMLPLPTEAFCDVELTIAATDELRVFKEAVLRE--RQAGEDLVS 423 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10047.98.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig10047.98.1 >prot_M-pyrifera_M_contig10047.98.1 ID=prot_M-pyrifera_M_contig10047.98.1|Name=mRNA_M-pyrifera_M_contig10047.98.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=73bp MDNAKRLFSFGFVTLSQHGQRSVSPFDRLSLPTESFCDVSFPAVSTDPLLback to top mRNA from alignment at M-pyrifera_M_contig10047:2601..2846+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig10047.98.1 ID=mRNA_M-pyrifera_M_contig10047.98.1|Name=mRNA_M-pyrifera_M_contig10047.98.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=246bp|location=Sequence derived from alignment at M-pyrifera_M_contig10047:2601..2846+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig10047:2601..2846+ >mRNA_M-pyrifera_M_contig10047.98.1 ID=mRNA_M-pyrifera_M_contig10047.98.1|Name=mRNA_M-pyrifera_M_contig10047.98.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=438bp|location=Sequence derived from alignment at M-pyrifera_M_contig10047:2601..2846+ (Macrocystis pyrifera P11B4 male)back to top |