mRNA_M-pyrifera_M_contig103866.823.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103866.823.1 vs. uniprot
Match: UPI001CEC696E (phytanoyl-CoA dioxygenase family protein n=1 Tax=Streptomyces sp. TML10 TaxID=2872625 RepID=UPI001CEC696E) HSP 1 Score: 63.9 bits (154), Expect = 7.120e-10 Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 1 Query: 1 IASSYFGKPAVLANWRAYRQLERSPIRHRAWEWHNDQRA----EELKFMLLLTDVHSDGQPMQYSLGSHQRVDIPAWQAETIFDMDDAL 255 I YF P+ + R YRQ P+R+RAW++H D + EE+K M+LLTDV DGQ ++Y GS Q Q +T F +D+AL Sbjct: 515 ILDEYFDGPSRFVSARGYRQGPCKPLRYRAWDYHQDMKTQGPREEVKVMVLLTDVTRDGQALRYVCGSQQVRWNFRTQRQTKFTLDEAL 603
BLAST of mRNA_M-pyrifera_M_contig103866.823.1 vs. uniprot
Match: UPI001672B73E (hypothetical protein n=1 Tax=Streptomyces lucensis TaxID=67319 RepID=UPI001672B73E) HSP 1 Score: 61.6 bits (148), Expect = 4.630e-9 Identity = 39/93 (41.94%), Postives = 54/93 (58.06%), Query Frame = 1 Query: 1 IASSYFGKPAVLANWRAYRQLERSPIRHRAWEWHNDQRA----EELKFMLLLTDVHSDGQPMQYSLGSHQRVDIPAWQAETI----FDMDDAL 255 I YF P+ + R YRQ P+R+RAW++H D + EELK M+LLTDV DGQ ++Y GS Q+V+ W ET F +D+A+ Sbjct: 515 ILDGYFDGPSRFVSARGYRQGPCKPLRYRAWDYHQDMKTKGPFEELKVMVLLTDVAPDGQALRYVCGS-QKVE---WDFETQRGTKFTLDEAV 603 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103866.823.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig103866.823.1 >prot_M-pyrifera_M_contig103866.823.1 ID=prot_M-pyrifera_M_contig103866.823.1|Name=mRNA_M-pyrifera_M_contig103866.823.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=91bp IASSYFGKPAVLANWRAYRQLERSPIRHRAWEWHNDQRAEELKFMLLLTDback to top mRNA from alignment at M-pyrifera_M_contig103866:21..293- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig103866.823.1 ID=mRNA_M-pyrifera_M_contig103866.823.1|Name=mRNA_M-pyrifera_M_contig103866.823.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=273bp|location=Sequence derived from alignment at M-pyrifera_M_contig103866:21..293- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig103866:21..293- >mRNA_M-pyrifera_M_contig103866.823.1 ID=mRNA_M-pyrifera_M_contig103866.823.1|Name=mRNA_M-pyrifera_M_contig103866.823.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=546bp|location=Sequence derived from alignment at M-pyrifera_M_contig103866:21..293- (Macrocystis pyrifera P11B4 male)back to top |