prot_M-pyrifera_M_contig103866.823.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103866.823.1 vs. uniprot
Match: UPI001CEC696E (phytanoyl-CoA dioxygenase family protein n=1 Tax=Streptomyces sp. TML10 TaxID=2872625 RepID=UPI001CEC696E) HSP 1 Score: 63.9 bits (154), Expect = 7.120e-10 Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 0 Query: 1 IASSYFGKPAVLANWRAYRQLERSPIRHRAWEWHNDQRA----EELKFMLLLTDVHSDGQPMQYSLGSHQRVDIPAWQAETIFDMDDAL 85 I YF P+ + R YRQ P+R+RAW++H D + EE+K M+LLTDV DGQ ++Y GS Q Q +T F +D+AL Sbjct: 515 ILDEYFDGPSRFVSARGYRQGPCKPLRYRAWDYHQDMKTQGPREEVKVMVLLTDVTRDGQALRYVCGSQQVRWNFRTQRQTKFTLDEAL 603
BLAST of mRNA_M-pyrifera_M_contig103866.823.1 vs. uniprot
Match: UPI001672B73E (hypothetical protein n=1 Tax=Streptomyces lucensis TaxID=67319 RepID=UPI001672B73E) HSP 1 Score: 61.6 bits (148), Expect = 4.630e-9 Identity = 39/93 (41.94%), Postives = 54/93 (58.06%), Query Frame = 0 Query: 1 IASSYFGKPAVLANWRAYRQLERSPIRHRAWEWHNDQRA----EELKFMLLLTDVHSDGQPMQYSLGSHQRVDIPAWQAETI----FDMDDAL 85 I YF P+ + R YRQ P+R+RAW++H D + EELK M+LLTDV DGQ ++Y GS Q+V+ W ET F +D+A+ Sbjct: 515 ILDGYFDGPSRFVSARGYRQGPCKPLRYRAWDYHQDMKTKGPFEELKVMVLLTDVAPDGQALRYVCGS-QKVE---WDFETQRGTKFTLDEAV 603 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103866.823.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103866.823.1 ID=prot_M-pyrifera_M_contig103866.823.1|Name=mRNA_M-pyrifera_M_contig103866.823.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=91bpback to top |