prot_M-pyrifera_M_contig10037.79.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10037.79.1 vs. uniprot
Match: D7G8S2_ECTSI (Molecular chaperone, heat shock protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8S2_ECTSI) HSP 1 Score: 68.2 bits (165), Expect = 7.720e-11 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 1 MFRCPVCDAKGKIGTTLGFGGTTCSLCQGRCYLRREP 37 M RCPVC+ GK GTTLGFGGTTC+LC G+C+LR EP Sbjct: 1 MTRCPVCEGSGKTGTTLGFGGTTCALCHGKCFLRTEP 37 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10037.79.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig10037.79.1 ID=prot_M-pyrifera_M_contig10037.79.1|Name=mRNA_M-pyrifera_M_contig10037.79.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=136bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|