mRNA_M-pyrifera_M_contig103605.765.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103605.765.1 vs. uniprot
Match: A0A7S2XXS1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2XXS1_9STRA) HSP 1 Score: 66.2 bits (160), Expect = 1.760e-10 Identity = 29/120 (24.17%), Postives = 61/120 (50.83%), Query Frame = 1 Query: 82 DLLRYFQFSYKQSSGYKGVGHFKLSGADDGGEEVEFCVACDPEEGVQCHYGEPRDSERPSFTVVMTVNDFLRVYSGQVCSSELMRMGVSGRIWVNGFAIRAVQQFATSFCYESGTWEAFY 441 DL+++F F++ +S ++G F + +A + C + + + S+ + +FL +YSGQ ++E++RMG++G++ + F + ++QFA F + W+ FY Sbjct: 19 DLMQFFCFAWNVNSSFRGTVQFSFPDTISSYDGKPLQLAVQVSDSGTCVFRDTPPDKEVSYEIKAPAREFLHIYSGQASATEMVRMGLTGKLQMRPFNVMQMRQFANCFDFSQEKWDEFY 138 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103605.765.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig103605.765.1 >prot_M-pyrifera_M_contig103605.765.1 ID=prot_M-pyrifera_M_contig103605.765.1|Name=mRNA_M-pyrifera_M_contig103605.765.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=162bp MDECATGPGEAIEEKTDAAAIDDLLRYFQFSYKQSSGYKGVGHFKLSGADback to top mRNA from alignment at M-pyrifera_M_contig103605:3..503- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig103605.765.1 ID=mRNA_M-pyrifera_M_contig103605.765.1|Name=mRNA_M-pyrifera_M_contig103605.765.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=501bp|location=Sequence derived from alignment at M-pyrifera_M_contig103605:3..503- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig103605:3..503- >mRNA_M-pyrifera_M_contig103605.765.1 ID=mRNA_M-pyrifera_M_contig103605.765.1|Name=mRNA_M-pyrifera_M_contig103605.765.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=972bp|location=Sequence derived from alignment at M-pyrifera_M_contig103605:3..503- (Macrocystis pyrifera P11B4 male)back to top |