prot_M-pyrifera_M_contig100287.66.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: UPI001CBB0724 (T9SS type A sorting domain-containing protein n=1 Tax=Aestuariivivens sp. NBU2969 TaxID=2873267 RepID=UPI001CBB0724) HSP 1 Score: 53.9 bits (128), Expect = 4.630e-6 Identity = 22/35 (62.86%), Postives = 25/35 (71.43%), Query Frame = 0 Query: 1 TVDCRDNCPSDPNKTRPGICGCGEADQDYDGDTVL 35 T +C D CP DPNKT PG+CGCG A+ D D D VL Sbjct: 66 TPNCLDGCPDDPNKTDPGVCGCGTAETDTDSDGVL 100
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A7S2V0L2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V0L2_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 4.790e-6 Identity = 19/28 (67.86%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 2 VDCRDNCPSDPNKTRPGICGCGEADQDY 29 VDC D CP+DP+KT PG+CGCG +D+DY Sbjct: 40 VDCDDQCPADPSKTEPGLCGCGMSDKDY 67
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A518LHA0_9BACT (Alpha-agarase n=3 Tax=Planctomycetes TaxID=203682 RepID=A0A518LHA0_9BACT) HSP 1 Score: 52.4 bits (124), Expect = 2.420e-5 Identity = 22/30 (73.33%), Postives = 23/30 (76.67%), Query Frame = 0 Query: 6 DNCPSDPNKTRPGICGCGEADQDYDGDTVL 35 D CP+DPNKT PG CGCG AD D DGD VL Sbjct: 260 DGCPNDPNKTAPGDCGCGVADDDADGDGVL 289
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A7C4JW05_9BACT (HYR domain-containing protein (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A7C4JW05_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 4.980e-5 Identity = 22/30 (73.33%), Postives = 23/30 (76.67%), Query Frame = 0 Query: 6 DNCPSDPNKTRPGICGCGEADQDYDGDTVL 35 DNCP D NKT PGICGCG AD D DGD +L Sbjct: 724 DNCPFDANKTEPGICGCGVADVDTDGDGLL 753
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A521K1J9_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A521K1J9_9BACT) HSP 1 Score: 51.2 bits (121), Expect = 5.340e-5 Identity = 20/28 (71.43%), Postives = 21/28 (75.00%), Query Frame = 0 Query: 1 TVDCRDNCPSDPNKTRPGICGCGEADQD 28 T DC D CP+DPNK PGICGCG AD D Sbjct: 7 TADCNDGCPTDPNKIAPGICGCGVADTD 34
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A1W9N1M1_9DELT (Uncharacterized protein (Fragment) n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9N1M1_9DELT) HSP 1 Score: 51.2 bits (121), Expect = 5.950e-5 Identity = 20/28 (71.43%), Postives = 21/28 (75.00%), Query Frame = 0 Query: 1 TVDCRDNCPSDPNKTRPGICGCGEADQD 28 T DC D CP+DPNKT PGICGCG D D Sbjct: 6 TPDCNDKCPNDPNKTEPGICGCGVPDTD 33
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A2N6C3W8_9DELT (Uncharacterized protein n=1 Tax=Desulfobulbaceae bacterium TaxID=2053307 RepID=A0A2N6C3W8_9DELT) HSP 1 Score: 51.2 bits (121), Expect = 6.230e-5 Identity = 20/29 (68.97%), Postives = 24/29 (82.76%), Query Frame = 0 Query: 6 DNCPSDPNKTRPGICGCGEADQDYDGDTV 34 DNCPSDP+KT+PGICGCG +D D D D + Sbjct: 23 DNCPSDPSKTQPGICGCGVSDADSDSDGI 51
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A3A0CNR9_9BACT (Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A3A0CNR9_9BACT) HSP 1 Score: 51.2 bits (121), Expect = 6.550e-5 Identity = 22/33 (66.67%), Postives = 24/33 (72.73%), Query Frame = 0 Query: 2 VDCRDNCPSDPNKTRPGICGCGEADQDYDGDTV 34 +D D CPSDPNKT PG CGCG AD D +GD V Sbjct: 643 IDDCDGCPSDPNKTSPGACGCGVADTDTEGDGV 675
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Match: A0A419F2J2_9BACT (HYR domain-containing protein (Fragment) n=1 Tax=Candidatus Abyssubacteria bacterium SURF_17 TaxID=2093361 RepID=A0A419F2J2_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 8.550e-5 Identity = 20/31 (64.52%), Postives = 22/31 (70.97%), Query Frame = 0 Query: 2 VDCRDNCPSDPNKTRPGICGCGEADQDYDGD 32 DC DNCP+DP KT PG+CGC AD D D D Sbjct: 1 ADCNDNCPTDPLKTEPGVCGCDVADTDSDAD 31 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100287.66.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 9
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100287.66.1 ID=prot_M-pyrifera_M_contig100287.66.1|Name=mRNA_M-pyrifera_M_contig100287.66.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=125bpback to top |