Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR004277 | Phosphatidyl serine synthase | PFAM | PF03034 | PSS | coord: 6..81 e-value: 7.8E-17 score: 61.9 |
None | No IPR available | PANTHER | PTHR15362:SF15 | PHOSPHATIDYLSERINE SYNTHASE 1 | coord: 8..81 |
None | No IPR available | PANTHER | PTHR15362 | PHOSPHATIDYLINOSITOL SYNTHASE | coord: 8..81 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99758.22929.1 ID=prot_M-pyrifera_M_contig99758.22929.1|Name=mRNA_M-pyrifera_M_contig99758.22929.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=81bp MGLKLERNTTVEKFEYGSKCDLNDWSHILVNIDTYYFEHLFGWVIGGFMI RSAGNAFMFSISWEVIEWEFMHVFRVFKECW back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR004277 | PSS |
|