prot_M-pyrifera_M_contig98995.22774.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98995.22774.1 vs. uniprot
Match: A0A1Z9UI35_9GAMM (Uncharacterized protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z9UI35_9GAMM) HSP 1 Score: 109 bits (273), Expect = 1.460e-26 Identity = 49/110 (44.55%), Postives = 74/110 (67.27%), Query Frame = 0 Query: 1 PVTDLELYLGTELHGAVWREDGRNFGHLHSYTPRVAAIMELAHEHELAPAARGARIAEMMVQLMCLEAELVFNGPEIPMRTVFPQAGRYHVFLQVAPGGEPVVFPFVIDV 110 PV+DL+L+LG+E H A+WR+DG+ FGH H+YTP + +M + + A I EMM+++M +EL+F GP IP+ +FPQ G+Y + + AP G P+VF F+I+V Sbjct: 194 PVSDLKLWLGSEAHVAIWRDDGKYFGHTHAYTPAMRQMMGGLAXQKKSHATNPKMIQEMMLRMMSQPSELIFEGPTIPVFYIFPQPGKYVMHFECAPNGNPIVFQFIINV 303 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98995.22774.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig98995.22774.1 ID=prot_M-pyrifera_M_contig98995.22774.1|Name=mRNA_M-pyrifera_M_contig98995.22774.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top |