prot_M-pyrifera_M_contig98804.22738.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98804.22738.1 vs. uniprot
Match: A0A7S0RYD6_9CHLO (Calcium uniporter protein n=1 Tax=Chlamydomonas leiostraca TaxID=1034604 RepID=A0A7S0RYD6_9CHLO) HSP 1 Score: 56.6 bits (135), Expect = 2.570e-6 Identity = 46/146 (31.51%), Postives = 69/146 (47.26%), Query Frame = 0 Query: 36 LSEYFELAGRCGLTH--AEAEEVLEHLHSAGVVLHFATDPDVEDIVLVKAEEVLDDVFGDL--GLEGPQKTFAKAQRSRKDAELAHLRAEIEPLQQVRSLVLDRARKTADRAMWGGFAGLLGVTGFYVYLTTTALSWDSVEPLVWI 177 L ++ ++A G+ + AEA EVL LH AGVVLH D+V ++AEE+ + V L G E Q+ K + D + H E ++R A+ +W G L G +++LT LSWD +EP +I Sbjct: 105 LDKFTQMAINSGVANNSAEATEVLNVLHKAGVVLHH------HDLVYLRAEEIAEMVMLMLPGGKESAQQKLQKVENELADLDKVHDDLE------------KKSRSVANMFLWSGLFILTGQFLGFIWLTWWELSWDVMEPFGYI 232 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98804.22738.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig98804.22738.1 ID=prot_M-pyrifera_M_contig98804.22738.1|Name=mRNA_M-pyrifera_M_contig98804.22738.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=178bpback to top |