prot_M-pyrifera_M_contig98692.22717.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98692.22717.1 vs. uniprot
Match: F0SG89_RUBBR (Uncharacterized protein n=3 Tax=Planctomycetaceae TaxID=126 RepID=F0SG89_RUBBR) HSP 1 Score: 60.1 bits (144), Expect = 9.390e-9 Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 0 Query: 4 DVTPSDQE-IPLKERIVNWLRTAAAAGYGLSLLLHGLLLLLMALWFFPQIKEAMSITTVVQSDTEELQPFDAMDDIHLESPAG 85 D P ++E +PL ERI NWL +AAAAGYG+SLL+H ++L++M+L ++ + T V E Q D MD + ++ PAG Sbjct: 41 DSQPEEEEQLPLTERIRNWLFSAAAAGYGMSLLVHAIILIIMSLVVIHELARQEQMNTTVTESGEVEQLEDVMD-VRIDLPAG 122
BLAST of mRNA_M-pyrifera_M_contig98692.22717.1 vs. uniprot
Match: A0A356AB97_9PLAN (Uncharacterized protein n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A356AB97_9PLAN) HSP 1 Score: 52.8 bits (125), Expect = 4.190e-6 Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = 0 Query: 1 PPPDVTPSDQEIP-LKERIVNWLRTAAAAGYGLSLLLHGLLLLLMALWFFPQIKEAMSITTVVQSDTEELQPFDAMDDIHLESPAG 85 PP V P D + + + + W +A AAGYG+SLL HGLLL+ M+L+FF + I + + ++ +E FD + D+ ++ P G Sbjct: 45 PPHAVEPFDFSLKGIFKAVKRWFHSAVAAGYGISLLFHGLLLIAMSLYFFSDYVQENYIESSIATN-DEAMVFDEVLDVRIDMPTG 129 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98692.22717.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig98692.22717.1 ID=prot_M-pyrifera_M_contig98692.22717.1|Name=mRNA_M-pyrifera_M_contig98692.22717.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bpback to top |