mRNA_M-pyrifera_M_contig98692.22717.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98692.22717.1 vs. uniprot
Match: F0SG89_RUBBR (Uncharacterized protein n=3 Tax=Planctomycetaceae TaxID=126 RepID=F0SG89_RUBBR) HSP 1 Score: 60.1 bits (144), Expect = 9.390e-9 Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 1 Query: 10 DVTPSDQE-IPLKERIVNWLRTAAAAGYGLSLLLHGLLLLLMALWFFPQIKEAMSITTVVQSDTEELQPFDAMDDIHLESPAG 255 D P ++E +PL ERI NWL +AAAAGYG+SLL+H ++L++M+L ++ + T V E Q D MD + ++ PAG Sbjct: 41 DSQPEEEEQLPLTERIRNWLFSAAAAGYGMSLLVHAIILIIMSLVVIHELARQEQMNTTVTESGEVEQLEDVMD-VRIDLPAG 122
BLAST of mRNA_M-pyrifera_M_contig98692.22717.1 vs. uniprot
Match: A0A356AB97_9PLAN (Uncharacterized protein n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A356AB97_9PLAN) HSP 1 Score: 52.8 bits (125), Expect = 4.190e-6 Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = 1 Query: 1 PPPDVTPSDQEIP-LKERIVNWLRTAAAAGYGLSLLLHGLLLLLMALWFFPQIKEAMSITTVVQSDTEELQPFDAMDDIHLESPAG 255 PP V P D + + + + W +A AAGYG+SLL HGLLL+ M+L+FF + I + + ++ +E FD + D+ ++ P G Sbjct: 45 PPHAVEPFDFSLKGIFKAVKRWFHSAVAAGYGISLLFHGLLLIAMSLYFFSDYVQENYIESSIATN-DEAMVFDEVLDVRIDMPTG 129 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98692.22717.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig98692.22717.1 >prot_M-pyrifera_M_contig98692.22717.1 ID=prot_M-pyrifera_M_contig98692.22717.1|Name=mRNA_M-pyrifera_M_contig98692.22717.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bp PPPDVTPSDQEIPLKERIVNWLRTAAAAGYGLSLLLHGLLLLLMALWFFPback to top mRNA from alignment at M-pyrifera_M_contig98692:58..312- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig98692.22717.1 ID=mRNA_M-pyrifera_M_contig98692.22717.1|Name=mRNA_M-pyrifera_M_contig98692.22717.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=255bp|location=Sequence derived from alignment at M-pyrifera_M_contig98692:58..312- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig98692:58..312- >mRNA_M-pyrifera_M_contig98692.22717.1 ID=mRNA_M-pyrifera_M_contig98692.22717.1|Name=mRNA_M-pyrifera_M_contig98692.22717.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=510bp|location=Sequence derived from alignment at M-pyrifera_M_contig98692:58..312- (Macrocystis pyrifera P11B4 male)back to top |