prot_M-pyrifera_M_contig94799.21869.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig94799.21869.1 vs. uniprot
Match: K3WA04_GLOUD (RYDR_ITPR domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WA04_GLOUD) HSP 1 Score: 58.2 bits (139), Expect = 7.430e-8 Identity = 30/90 (33.33%), Postives = 55/90 (61.11%), Query Frame = 0 Query: 2 SLRSLTRYDVVSSLLDLVLYEHNGLVDAALSLLFAYFTQHAALVDALEGVQLLVSSTTVRVFRHVDGLRVRLQTVVETSEVWLGLSDERD 91 SL L+R +V + L+ +++YE+ LV AL LL + QH +V A++ +QLL++ T+ ++ + L+ + ET+EVW+ L+ + D Sbjct: 119 SLAQLSRRNVTTVLMQMLMYEYPPLVSKALELLLQQYNQHDQVVKAMQKLQLLITQETISIYNKLKDDVDNLRRLSETTEVWMDLTSKSD 208 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig94799.21869.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig94799.21869.1 ID=prot_M-pyrifera_M_contig94799.21869.1|Name=mRNA_M-pyrifera_M_contig94799.21869.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=91bpback to top |