prot_M-pyrifera_M_contig91257.21147.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91257.21147.1 vs. uniprot
Match: D7FYR1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYR1_ECTSI) HSP 1 Score: 81.3 bits (199), Expect = 2.560e-17 Identity = 39/64 (60.94%), Postives = 46/64 (71.88%), Query Frame = 0 Query: 2 SGVGGYGNELEYGAWVCFFLCEEALRNGTWSERDVRYCFHLVDETGRGRVGMAEVTRFFEDMVS 65 +G+G L Y AWVCF+LCEEAL++GT S RDVRYCF L+DE GRVG+ EV F ED VS Sbjct: 125 TGLGCRRETLGYDAWVCFWLCEEALQSGTCSRRDVRYCFALLDEGNLGRVGVREVEPFVEDAVS 188
BLAST of mRNA_M-pyrifera_M_contig91257.21147.1 vs. uniprot
Match: A0A6H5JXN3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXN3_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 2.520e-16 Identity = 36/52 (69.23%), Postives = 40/52 (76.92%), Query Frame = 0 Query: 11 LEYGAWVCFFLCEEALRNGTWSERDVRYCFHLVDETGRGRVGMAEVTRFFED 62 L Y AWVCF+LCEEALR+GT S RDVRYCF L+DE GRVG+ EV F ED Sbjct: 124 LGYDAWVCFWLCEEALRSGTCSRRDVRYCFALLDEGNLGRVGVREVEPFIED 175 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91257.21147.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91257.21147.1 ID=prot_M-pyrifera_M_contig91257.21147.1|Name=mRNA_M-pyrifera_M_contig91257.21147.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=65bpback to top |