prot_M-pyrifera_M_contig9093.21083.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9093.21083.1 vs. uniprot
Match: A0A6H5L1S0_9PHAE (UBX domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1S0_9PHAE) HSP 1 Score: 107 bits (268), Expect = 6.810e-26 Identity = 54/66 (81.82%), Postives = 58/66 (87.88%), Query Frame = 0 Query: 222 LEDPPEDDSPDKTSVRFQFPTGARVLRKFRKNSDVRQLFLFVRSELGGAETKSFDVRTVRPPTSVR 287 LEDPP DD +K SVRFQFPTGARVLRKFRK+SDVRQLFLFVR+EL GA+ K FDVRTVRPP SVR Sbjct: 19 LEDPPGDDCAEKISVRFQFPTGARVLRKFRKSSDVRQLFLFVRTELEGAKAKPFDVRTVRPPCSVR 84
BLAST of mRNA_M-pyrifera_M_contig9093.21083.1 vs. uniprot
Match: D7FS95_ECTSI (UBX domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS95_ECTSI) HSP 1 Score: 106 bits (265), Expect = 3.030e-22 Identity = 53/66 (80.30%), Postives = 58/66 (87.88%), Query Frame = 0 Query: 222 LEDPPEDDSPDKTSVRFQFPTGARVLRKFRKNSDVRQLFLFVRSELGGAETKSFDVRTVRPPTSVR 287 LEDPP DD +K SVRFQFPTGARVLR+FRK+SDVRQLFLFVR+EL GA+ K FDVRTVRPP SVR Sbjct: 521 LEDPPGDDCAEKISVRFQFPTGARVLRRFRKSSDVRQLFLFVRTELEGAKAKPFDVRTVRPPCSVR 586 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9093.21083.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig9093.21083.1 ID=prot_M-pyrifera_M_contig9093.21083.1|Name=mRNA_M-pyrifera_M_contig9093.21083.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=287bpback to top |