prot_M-pyrifera_M_contig90417.20959.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90417.20959.1 vs. uniprot
Match: D8LF97_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LF97_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 2.180e-9 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 1 MLQRSVSLLRRFPQAESIDLTFATAETEERLRVWVHKTLSV 41 ML+RS+SLLRR P ESIDLTFAT + EE LR+WVHK L+V Sbjct: 102 MLRRSLSLLRRHPHPESIDLTFATPKLEESLRLWVHKRLAV 142 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90417.20959.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig90417.20959.1 ID=prot_M-pyrifera_M_contig90417.20959.1|Name=mRNA_M-pyrifera_M_contig90417.20959.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bpback to top |