mRNA_M-pyrifera_M_contig90417.20959.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90417.20959.1 vs. uniprot
Match: D8LF97_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LF97_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 1.360e-10 Identity = 31/49 (63.27%), Postives = 38/49 (77.55%), Query Frame = 1 Query: 1 GDTDLARNMLQRSVSLLRRFPQAESIDLTFATAETEERLRVWVHKTLSV 147 GD+ +ML+RS+SLLRR P ESIDLTFAT + EE LR+WVHK L+V Sbjct: 94 GDSHNTASMLRRSLSLLRRHPHPESIDLTFATPKLEESLRLWVHKRLAV 142 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90417.20959.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90417.20959.1 >prot_M-pyrifera_M_contig90417.20959.1 ID=prot_M-pyrifera_M_contig90417.20959.1|Name=mRNA_M-pyrifera_M_contig90417.20959.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bp MLQRSVSLLRRFPQAESIDLTFATAETEERLRVWVHKTLSVK*back to top mRNA from alignment at M-pyrifera_M_contig90417:144..296+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90417.20959.1 ID=mRNA_M-pyrifera_M_contig90417.20959.1|Name=mRNA_M-pyrifera_M_contig90417.20959.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig90417:144..296+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90417:144..296+ >mRNA_M-pyrifera_M_contig90417.20959.1 ID=mRNA_M-pyrifera_M_contig90417.20959.1|Name=mRNA_M-pyrifera_M_contig90417.20959.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig90417:144..296+ (Macrocystis pyrifera P11B4 male)back to top |