prot_M-pyrifera_M_contig88575.20562.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Match: A0A3S3PJ55_9ACAR (Kinase n=1 Tax=Dinothrombium tinctorium TaxID=1965070 RepID=A0A3S3PJ55_9ACAR) HSP 1 Score: 62.8 bits (151), Expect = 1.590e-9 Identity = 32/80 (40.00%), Postives = 53/80 (66.25%), Query Frame = 0 Query: 5 KYVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMPGWELGFRLTGLRAWRRRTKEQVVRERAFGKSLS 84 K++ + DL AG +K SV+D+KVG T+ P+A +K +E +KY LGFR+ G+R +++ T E +V++ FGK+L+ Sbjct: 112 KFLAMDDLCAGY--QKPSVMDIKVGAITYDPEADKDKIEKEISKYPWAKTLGFRILGIRLYKKATDEYIVKDSYFGKTLT 189
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Match: A0A7R9LRS6_9ACAR (Kinase n=1 Tax=Oppiella nova TaxID=334625 RepID=A0A7R9LRS6_9ACAR) HSP 1 Score: 55.5 bits (132), Expect = 5.850e-7 Identity = 28/80 (35.00%), Postives = 50/80 (62.50%), Query Frame = 0 Query: 5 KYVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMPGWELGFRLTGLRAWRRRTKEQVVRERAFGKSLS 84 +Y+ L+D+ G+ + S++DVK+G T+ P+A+ K E KY LGFRL G+R ++ + E +V+++ +G SL+ Sbjct: 105 EYLRLEDMTNGMTSP--SILDVKIGPKTYDPEANERKIASESGKYRFAELLGFRLLGMRIYKSKDNEYIVKDKDYGISLT 182
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Match: A0A6M2CTN3_RHIMP (Kinase (Fragment) n=2 Tax=Rhipicephalus microplus TaxID=6941 RepID=A0A6M2CTN3_RHIMP) HSP 1 Score: 52.0 bits (123), Expect = 9.050e-6 Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 0 Query: 5 KYVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMPGWELGFRLTGLRAWRRRTKEQVVRERAFGKSLSVAEAPMAIV 93 +Y+ L D+ + R+ V+DVK+G T+ P A EK E KY GW+LGFR+ G+R + ++ V +GK + + P I+ Sbjct: 95 EYLRLDDVTR--EFRRPCVMDVKIGAQTYDPLAPPEKVALEEAKYRWGWQLGFRILGMRVFDHSEQKYHV----YGKDYGLKQTPDTIL 177 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig88575.20562.1 ID=prot_M-pyrifera_M_contig88575.20562.1|Name=mRNA_M-pyrifera_M_contig88575.20562.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=94bpback to top |