mRNA_M-pyrifera_M_contig88575.20562.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Match: A0A3S3PJ55_9ACAR (Kinase n=1 Tax=Dinothrombium tinctorium TaxID=1965070 RepID=A0A3S3PJ55_9ACAR) HSP 1 Score: 62.0 bits (149), Expect = 4.130e-9 Identity = 32/80 (40.00%), Postives = 53/80 (66.25%), Query Frame = 1 Query: 40 KYVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMPGWELGFRLTGLRAWRRRTKEQVVRERAFGKSLS 279 K++ + DL AG +K SV+D+KVG T+ P+A +K +E +KY LGFR+ G+R +++ T E +V++ FGK+L+ Sbjct: 112 KFLAMDDLCAGY--QKPSVMDIKVGAITYDPEADKDKIEKEISKYPWAKTLGFRILGIRLYKKATDEYIVKDSYFGKTLT 189
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Match: A0A7R9LRS6_9ACAR (Kinase n=1 Tax=Oppiella nova TaxID=334625 RepID=A0A7R9LRS6_9ACAR) HSP 1 Score: 54.7 bits (130), Expect = 1.500e-6 Identity = 28/79 (35.44%), Postives = 49/79 (62.03%), Query Frame = 1 Query: 43 YVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMPGWELGFRLTGLRAWRRRTKEQVVRERAFGKSLS 279 Y+ L+D+ G+ + S++DVK+G T+ P+A+ K E KY LGFRL G+R ++ + E +V+++ +G SL+ Sbjct: 106 YLRLEDMTNGMTSP--SILDVKIGPKTYDPEANERKIASESGKYRFAELLGFRLLGMRIYKSKDNEYIVKDKDYGISLT 182
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Match: A0A6M2CTN3_RHIMP (Kinase (Fragment) n=2 Tax=Rhipicephalus microplus TaxID=6941 RepID=A0A6M2CTN3_RHIMP) HSP 1 Score: 51.2 bits (121), Expect = 2.310e-5 Identity = 30/88 (34.09%), Postives = 47/88 (53.41%), Query Frame = 1 Query: 43 YVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMPGWELGFRLTGLRAWRRRTKEQVVRERAFGKSLSVAEAPMAIV 306 Y+ L D+ + R+ V+DVK+G T+ P A EK E KY GW+LGFR+ G+R + ++ V +GK + + P I+ Sbjct: 96 YLRLDDVTR--EFRRPCVMDVKIGAQTYDPLAPPEKVALEEAKYRWGWQLGFRILGMRVFDHSEQKYHV----YGKDYGLKQTPDTIL 177 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88575.20562.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig88575.20562.1 >prot_M-pyrifera_M_contig88575.20562.1 ID=prot_M-pyrifera_M_contig88575.20562.1|Name=mRNA_M-pyrifera_M_contig88575.20562.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=94bp MPRGKYVLLQDLRAGLDARKVSVVDVKVGGTTWGPDASAEKALREGTKYMback to top mRNA from alignment at M-pyrifera_M_contig88575:19..327- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig88575.20562.1 ID=mRNA_M-pyrifera_M_contig88575.20562.1|Name=mRNA_M-pyrifera_M_contig88575.20562.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=309bp|location=Sequence derived from alignment at M-pyrifera_M_contig88575:19..327- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig88575:19..327- >mRNA_M-pyrifera_M_contig88575.20562.1 ID=mRNA_M-pyrifera_M_contig88575.20562.1|Name=mRNA_M-pyrifera_M_contig88575.20562.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=564bp|location=Sequence derived from alignment at M-pyrifera_M_contig88575:19..327- (Macrocystis pyrifera P11B4 male)back to top |