prot_M-pyrifera_M_contig88307.20508.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: D8LSU3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSU3_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 1.200e-18 Identity = 34/40 (85.00%), Postives = 38/40 (95.00%), Query Frame = 0 Query: 1 MYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTRG 40 MYAARAWD+HDLLHQC+EVERD+HWWHVLTSLG+ FD RG Sbjct: 1880 MYAARAWDNHDLLHQCMEVERDSHWWHVLTSLGIAFDNRG 1919
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A6H5KS52_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS52_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 1.200e-18 Identity = 34/40 (85.00%), Postives = 38/40 (95.00%), Query Frame = 0 Query: 1 MYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTRG 40 MYAARAWD+HDLLHQC+EVERD+HWWHVLTSLG+ FD RG Sbjct: 441 MYAARAWDNHDLLHQCMEVERDSHWWHVLTSLGITFDNRG 480
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A0N7L774_PLAHL (Kinetochore component n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0N7L774_PLAHL) HSP 1 Score: 52.4 bits (124), Expect = 1.040e-6 Identity = 20/37 (54.05%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH LT LG+ D + Sbjct: 1471 AARAWQQIAFLHQCVELEENARWWHYLTLLGIECDHK 1507
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A6A3NKS0_9STRA (Rod_C domain-containing protein n=6 Tax=Phytophthora TaxID=4783 RepID=A0A6A3NKS0_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 4.970e-6 Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW + LHQC+E+E +A WWH L LG+ D + Sbjct: 1497 AARAWQEIAFLHQCVELEGNARWWHYLNLLGIECDHK 1533
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A833VZF6_PHYIN (Rough deal protein C-terminal region n=1 Tax=Phytophthora infestans TaxID=4787 RepID=A0A833VZF6_PHYIN) HSP 1 Score: 50.1 bits (118), Expect = 6.800e-6 Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH L+ LG+ D + Sbjct: 1283 AARAWQQIAFLHQCVELEGNARWWHYLSLLGIECDHK 1319
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: D0NTT7_PHYIT (Rod_C domain-containing protein n=1 Tax=Phytophthora infestans (strain T30-4) TaxID=403677 RepID=D0NTT7_PHYIT) HSP 1 Score: 50.1 bits (118), Expect = 6.800e-6 Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH L+ LG+ D + Sbjct: 634 AARAWQQIAFLHQCVELEGNARWWHYLSLLGIECDHK 670
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: W2QUK9_PHYPN (Rod_C domain-containing protein n=28 Tax=Phytophthora TaxID=4783 RepID=W2QUK9_PHYPN) HSP 1 Score: 49.7 bits (117), Expect = 9.300e-6 Identity = 19/37 (51.35%), Postives = 24/37 (64.86%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 1428 AARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 1464
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: G4Z2Z9_PHYSP (Rod_C domain-containing protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z2Z9_PHYSP) HSP 1 Score: 49.7 bits (117), Expect = 9.300e-6 Identity = 19/37 (51.35%), Postives = 24/37 (64.86%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 666 AARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 702
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A225V152_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225V152_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 9.310e-6 Identity = 19/37 (51.35%), Postives = 24/37 (64.86%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 767 AARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 803
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A0W8DCK1_PHYNI (Uncharacterized protein n=1 Tax=Phytophthora nicotianae TaxID=4790 RepID=A0A0W8DCK1_PHYNI) HSP 1 Score: 49.7 bits (117), Expect = 9.310e-6 Identity = 19/37 (51.35%), Postives = 24/37 (64.86%), Query Frame = 0 Query: 3 AARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 39 AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 703 AARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 739 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 12
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig88307.20508.1 ID=prot_M-pyrifera_M_contig88307.20508.1|Name=mRNA_M-pyrifera_M_contig88307.20508.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=41bpback to top |